Align PTS system N-acetylglucosamine-specific EIIB component; PTS system GlcNAc-specific EIIB component; N-acetylglucosamine-specific phosphotransferase enzyme IIB component; GlcNAc-specific phosphotransferase enzyme IIB component; EC 2.7.1.193 (characterized)
to candidate WP_019613932.1 G327_RS0106400 PTS glucose transporter subunit IIBC
Query= SwissProt::Q9S2H6 (77 letters) >NCBI__GCF_000381745.1:WP_019613932.1 Length = 468 Score = 66.6 bits (161), Expect = 2e-16 Identities = 32/67 (47%), Positives = 44/67 (65%) Query: 8 IVAGLGGIDNIDEIEGCITRLRTEVNDPALVNEAALKAAGAHGVVKMGTAIQVVIGTDAD 67 +VA GG NI+ ++ CITRLR VND ALV++A LK GA GVV G +Q + GT +D Sbjct: 397 LVAAFGGKANIENLDACITRLRISVNDIALVDKAELKKLGAAGVVVSGNGVQAIFGTKSD 456 Query: 68 PIAAEIE 74 + ++E Sbjct: 457 NLKTDME 463 Lambda K H 0.315 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 90 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 77 Length of database: 468 Length adjustment: 19 Effective length of query: 58 Effective length of database: 449 Effective search space: 26042 Effective search space used: 26042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory