Align PTS system N-acetylglucosamine-specific EIIC component; PTS system GlcNAc-specific EIIC component; GlcNAc-specific transporter; N-acetylglucosamine permease IIC component; GlcNAc permease IIC component (characterized)
to candidate WP_019613932.1 G327_RS0106400 PTS glucose transporter subunit IIBC
Query= SwissProt::Q9S2H4 (416 letters) >NCBI__GCF_000381745.1:WP_019613932.1 Length = 468 Score = 297 bits (761), Expect = 4e-85 Identities = 170/403 (42%), Positives = 247/403 (61%), Gaps = 26/403 (6%) Query: 18 LFQGLQKVGRSLQLPIAVLPAAGIMVRLGQDDIFGKDGLGWDKVAAVFNNAGGALTGSLP 77 +F LQKVG+SL LP++VLP AGI++ +G K + + V+ + AGGA+ G++ Sbjct: 3 IFGSLQKVGKSLMLPVSVLPIAGILLGVGA----AKFAILPEVVSQLMEQAGGAVFGNMA 58 Query: 78 ILFCIGVAIGFAKKADGSTALAAVVGFLVYSKVLEAFPVTEAVVQDGADVAATYNDPGVL 137 +LF IGVA+GF K DG LAA VG+ + + +E + GA+ GVL Sbjct: 59 LLFAIGVALGFTKN-DGVAGLAAAVGYYIMMQTVET-------LAPGANT-------GVL 103 Query: 138 GGIIMGLLAAVLWQRYHRKKLVDWLGFFNGRRLVPIIMAFVGIVVGVFFGLVWEPIGDGI 197 GGII G +AA ++ R++ L ++LGFF G+R VPI+ IV+G ++W PIG I Sbjct: 104 GGIIAGGIAAAMFNRFYNITLPEYLGFFAGKRAVPIMTGLSAIVMGAVLAVIWPPIGSAI 163 Query: 198 SNFGEWMTGLGSGGA-ALFGGVNRALIPVGMHQFVNTVAWFQLGDFTNSAGDVVHGDITR 256 + F +W A ++G V R+LIP G+H N +F+ G T+++G+ ++G +T Sbjct: 164 AAFSDWAAHQNPTVAFGIYGVVERSLIPFGLHHIWNVPFFFEAGSCTSASGEQLNGILTC 223 Query: 257 FLAGDPSA-----GIFQ-AGFFPIMMFGLPAAALAMAHTARPERRKAVLGMMISLAATSF 310 +L+ D + G Q AG + MFGLPAAA+A+AH+A+PE R V+G+M S A TSF Sbjct: 224 YLSADDATRAAGNGFGQLAGGYMFKMFGLPAAAIAIAHSAKPENRAKVMGIMASAALTSF 283 Query: 311 VTGVTEPIEFSFMFIAPVLYVLHAVLTAISMAITWGLGVHAGFNFSAGFIDYALNWHLAT 370 +TG+TEPIEF+F+F+APVLY +HA+L + +T LG+ G +FS G ID+ + A Sbjct: 284 LTGITEPIEFAFLFVAPVLYAIHALLAGSAFVVTNMLGMVHGTSFSHGLIDFLVLSANAE 343 Query: 371 KPWLIIPIGLVFAAIYYVTFRFAIVKFNLKTPGREPEEEVEDL 413 K + IGLV+AAIYY FR I +LKTPGRE EE E++ Sbjct: 344 KMIYFVVIGLVYAAIYYTLFRIVIKALDLKTPGREDEEAEEEV 386 Lambda K H 0.326 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 24 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 468 Length adjustment: 32 Effective length of query: 384 Effective length of database: 436 Effective search space: 167424 Effective search space used: 167424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory