Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate WP_026340224.1 G329_RS0114590 ABC transporter permease subunit
Query= uniprot:A0A0H3PA28 (219 letters) >NCBI__GCF_000381785.1:WP_026340224.1 Length = 367 Score = 104 bits (259), Expect = 3e-27 Identities = 65/216 (30%), Positives = 113/216 (52%), Gaps = 4/216 (1%) Query: 3 NVFNAQNIE-FLMQGLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIFR 61 N F +E L GL LTL +A+ + S+ G LA+ + + + + +I+I+R Sbjct: 143 NSFGLIQVETHLWGGLSLTLVLAVVGIVASLPLGIVLALGRQSEMPIVRSVCVIFIEIWR 202 Query: 62 NTPLLLWMLAACFVLPVFFGQ---FPQAFWGTIGFSLYTSSVMAEIIRGGLNSIPKGQFE 118 PL+ + A +LP+FF + F + IG +L+ S+ MAE+IRGGL +IPKGQ+E Sbjct: 203 GVPLITVLFMASVMLPLFFPEGMSFDKLLRALIGITLFQSAYMAEVIRGGLQAIPKGQYE 262 Query: 119 AAYSQGFGKFFTLFYIILPQTFRKIIPALLSQIVTTVKDTAYLAGLGIAELTYNSKTILA 178 AA + G G + + II+PQ + +IP +++ + KDT+ + +G+ +L + Sbjct: 263 AADALGLGYWQKMILIIMPQALKLMIPGIVNTFIALFKDTSLVLIIGLFDLLAIGQAANQ 322 Query: 179 KLTSFEEILAMIGVVAGIYFIICFSLSMLVRYYAKK 214 VA ++++ CFS+S + +K Sbjct: 323 DPKWIGYSTESYLFVALMFWVFCFSMSRYSQQLERK 358 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 367 Length adjustment: 26 Effective length of query: 193 Effective length of database: 341 Effective search space: 65813 Effective search space used: 65813 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory