Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate WP_019620489.1 G329_RS0103095 aldehyde dehydrogenase
Query= BRENDA::Q4DRT8 (561 letters) >NCBI__GCF_000381785.1:WP_019620489.1 Length = 494 Score = 146 bits (368), Expect = 2e-39 Identities = 128/441 (29%), Positives = 206/441 (46%), Gaps = 31/441 (7%) Query: 89 QKAIDTALQASRE------WSQTSFRDRAAIFLHAAHLISTKYRHELRAATMLGQSKSPF 142 Q +D A+ +RE WS+ R+R A+LI +++ E L KS Sbjct: 54 QADVDIAVANAREVFKSGVWSEIPPRERKKAMQKWANLIE-QHQDEFALLDTLDMGKSIS 112 Query: 143 QAEIDVIAESCDFLRFSVHYAENLYRDQPLSPSSGAVWNSLDYRPLEGFVSTIAPFNFAA 202 + + ++ D +R++ + +Y + ++P+ + ++P+ G V I P+N+ Sbjct: 113 EMVNIDVPDAIDCIRWTAESIDKIYGE--IAPTGDDTLAMIHHQPV-GVVGAITPWNYPL 169 Query: 203 IAANLVACPALM-GNVVLWKPSPHAVLSNYLLYKVFEEAGLPAGVVNFLPCEPDVMTNFV 261 + + PAL GN V+ KPS + LS L ++ EAG+PAGV N LP + Sbjct: 170 LMVSWKIAPALAAGNSVILKPSEKSPLSALRLAELAVEAGIPAGVFNVLPGFGHTAGKAL 229 Query: 262 NSHRDLAGVAFTGSTKVFMSINKQIYARLEEYRNIPRISGETGGKDFHLVHPSADLKLAA 321 H D+ +AFTGST+V + YA N+ R+ E GGK +LV AD+K AA Sbjct: 230 ALHMDVNVLAFTGSTRVAGMLMG--YAGES---NMKRVWLEAGGKSPNLVFADADIKAAA 284 Query: 322 ALTVRGAFEFQGQKCSATSRLYAPKSRWEELKNYMLGVHEQLKMGQPDDFKSFMCAVIDE 381 A + F QG+ C A SRLY KS EE ++ + G P D + M ++D Sbjct: 285 AASAAAIFCNQGEVCIACSRLYVDKSIKEEFVAALVEAAASFQPGDPLDPATTMGPMVDG 344 Query: 382 TAFERNKKYIDIAKSSPSTYSVIAGG--GYDKTEGWFVQPTIVESKDSQAQLMHEEIFGP 439 T ++YI A+ VI GG Y + +G+F +PTIV+ + + EEIFGP Sbjct: 345 TQLAIVERYIRSAEEEGG--QVIMGGVPEYQEGKGFFAKPTIVDGAHNGMTFVKEEIFGP 402 Query: 440 ILTVHVYDDSKPGFWSDVCDVVNRSTKYALTGSIFAQDRQAIRDATTKHLRYAAGNYYIN 499 +L V ++ + + + Y L +++ Q+ + K +G ++N Sbjct: 403 VLAVCEFETEEEAI------ALANDSVYGLGAAVWTQNLSRAHRVSRK---VESGMVWVN 453 Query: 500 DKCTGAVVGQQPFGGARASGS 520 G PFGG +ASG+ Sbjct: 454 --TWGEGDSTVPFGGVKASGN 472 Lambda K H 0.320 0.133 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 595 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 561 Length of database: 494 Length adjustment: 35 Effective length of query: 526 Effective length of database: 459 Effective search space: 241434 Effective search space used: 241434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory