Align Beta-ketothiolase BktB; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_019620367.1 G329_RS0102470 beta-ketothiolase BktB
Query= SwissProt::Q0KBP1 (394 letters) >NCBI__GCF_000381785.1:WP_019620367.1 Length = 394 Score = 478 bits (1229), Expect = e-139 Identities = 249/392 (63%), Positives = 290/392 (73%), Gaps = 1/392 (0%) Query: 3 REVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQTEP 62 REVVV+SGVRTAIG FGGSLK P EL V EA++R+ + +D GH VFGNVI TE Sbjct: 4 REVVVLSGVRTAIGGFGGSLKSQTPCELATTCVSEAVSRSGAAAEDFGHSVFGNVIHTER 63 Query: 63 RDMYLGRVAAVNGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESMSR 122 RDMYLGRVAAVNGG+ P +T+NRLCGSGLQAI+SA Q I LG D A+ GG+E MS+ Sbjct: 64 RDMYLGRVAAVNGGLPHETPGVTINRLCGSGLQAIISATQQIELGVCDAAVAGGSEVMSK 123 Query: 123 APYLAPAARWGARMGDAGLVDMMLGALHDPFHRIHMGVTAENVAKEYDISRAQQDEAALE 182 + Y P AR+G RMGD +VD M+GAL PF HMG+TAEN+A ++ +SR QD A+ Sbjct: 124 SQYWMPTARFGQRMGDGAIVDAMVGALTCPFDDTHMGITAENIADKWQVSREDQDALAVM 183 Query: 183 SHRRASAAIKAGYFKDQIVPVVSKGRKGDVTFDTDEHVRHDATIDDMTKLRPVFVKENGT 242 SH A AI G FK+QIVP+ K RKG FDTDEH+R+ T DM KLRP F K +G+ Sbjct: 184 SHNNAERAITEGRFKEQIVPIELKSRKGVTVFDTDEHLRYGCTTADMEKLRPAF-KRDGS 242 Query: 243 VTAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKAMGIGPVPATKIAL 302 VTAGNASGLNDAAAAV +M AE +GLKP+ARLV Y AGV+PK MGIGPVPA + L Sbjct: 243 VTAGNASGLNDAAAAVTLMAAETAEAKGLKPMARLVGYSFAGVEPKYMGIGPVPAVRKLL 302 Query: 303 ERAGLQVSDLDVIEANEAFAAQACAVTKALGLDPAKVNPNGSGISLGHPIGATGALITVK 362 A L + D+DV E NEAFAAQA AV + L L KVN NGSGISLGHPIGATGA+ITVK Sbjct: 303 ADAELSIGDIDVWEVNEAFAAQALAVCRDLELPLEKVNVNGSGISLGHPIGATGAIITVK 362 Query: 363 ALHELNRVQGRYALVTMCIGGGQGIAAIFERI 394 ALHEL R GRYA+VTMCIGGGQGIAA+FER+ Sbjct: 363 ALHELQRSGGRYAVVTMCIGGGQGIAALFERV 394 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 394 Length adjustment: 31 Effective length of query: 363 Effective length of database: 363 Effective search space: 131769 Effective search space used: 131769 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_019620367.1 G329_RS0102470 (beta-ketothiolase BktB)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.1399686.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-135 438.1 3.0 1.6e-135 437.9 3.0 1.0 1 NCBI__GCF_000381785.1:WP_019620367.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000381785.1:WP_019620367.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.9 3.0 1.6e-135 1.6e-135 1 385 [] 8 392 .. 8 392 .. 0.98 Alignments for each domain: == domain 1 score: 437.9 bits; conditional E-value: 1.6e-135 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaalaaglpe 72 ++++vRt+ig +ggslk+ ++ +L+++ ++e++ r+g +e+ + ++Gnv+++ + + ++R aa++ glp+ NCBI__GCF_000381785.1:WP_019620367.1 8 VLSGVRTAIGGFGGSLKSQTPCELATTCVSEAVSRSGAAAEDFGHSVFGNVIHTERRdMYLGRVAAVNGGLPH 80 689*******99*******************************************999*************** PP TIGR01930 73 svpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdl. 144 ++p++t+nr+C+SglqA+++a q+i+ G +d++vaGG E mS++ ++++ + r + ++g+ d+++ l NCBI__GCF_000381785.1:WP_019620367.1 81 ETPGVTINRLCGSGLQAIISATQQIELGVCDAAVAGGSEVMSKSQYWMPTA--RFGQRMGDGAIVDAMVGALt 151 *************************************************98..89999999999998888889 PP TIGR01930 145 .vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..kkvvskDegirpn 214 + ++ +mg+tAen+a+k+++sRe+qD++a+ Sh++a++Ai eg+fk++ivp+e+k + +v+++De++r + NCBI__GCF_000381785.1:WP_019620367.1 152 cPFDDTHMGITAENIADKWQVSREDQDALAVMSHNNAERAITEGRFKEQIVPIELKSRkgVTVFDTDEHLRYG 224 999*****************************************************999999*********** PP TIGR01930 215 ttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpv 287 t +++ kL+pafk+ +gs vtAgN+s+lnD+Aaa+ lm e+a+++gl+p+ar+v++++agv+p++mg+gpv NCBI__GCF_000381785.1:WP_019620367.1 225 CTTADMEKLRPAFKR-DGS-VTAGNASGLNDAAAAVTLMAAETAEAKGLKPMARLVGYSFAGVEPKYMGIGPV 295 *************96.9*7.***************************************************** PP TIGR01930 288 pAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeL 360 pA++k+L+ a+lsi did++E+nEAFAaq+lav ++l+ l lekvNvnG+ i+lGHP+Ga+Ga+i+++ l+eL NCBI__GCF_000381785.1:WP_019620367.1 296 PAVRKLLADAELSIGDIDVWEVNEAFAAQALAVCRDLE-LPLEKVNVNGSGISLGHPIGATGAIITVKALHEL 367 **************************************.88******************************** PP TIGR01930 361 kergkkyGlatlCvggGqGaAvile 385 ++ g++y+++t+C+ggGqG+A+++e NCBI__GCF_000381785.1:WP_019620367.1 368 QRSGGRYAVVTMCIGGGQGIAALFE 392 **********************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 24.88 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory