Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_019620414.1 G329_RS0102710 2,3-dehydroadipyl-CoA hydratase
Query= BRENDA::F4JML5 (301 letters) >NCBI__GCF_000381785.1:WP_019620414.1 Length = 259 Score = 169 bits (428), Expect = 6e-47 Identities = 95/253 (37%), Positives = 148/253 (58%), Gaps = 3/253 (1%) Query: 48 LSGSDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGA 107 +SG +G++ + L RP NA+N ++L+ L E+ ++N V+I F AGA Sbjct: 9 ISGPSNGVLTITLHRPEALNALNTKLLEELVEQLEAAEKNNDIGAVVITGSAKA-FAAGA 67 Query: 108 DLKERRTMSPSEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGE 167 D++E ++ V + + + A P IAA+ G GGG E+A+ D+ I GE Sbjct: 68 DVREMASLDA--VGVLKDPRVEHWKRVTAFKKPIIAAVNGFCFGGGCELAMHADIIIAGE 125 Query: 168 NAVFGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAG 227 +A FG PE L I+PGAGGTQRL R VG+S++ +++ TG I A +A + GL++ + Sbjct: 126 DAKFGQPEIKLGIMPGAGGTQRLLRSVGKSLAMQMVLTGEPITAGQAMSAGLISEITLSE 185 Query: 228 EAHEKAIEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGL 287 E+A +A QI+ P+A++MAK A+ + +T+++SGL E + L T+DR EG+ Sbjct: 186 MTLERAQTVAAQISRHAPIAVEMAKDALLKAFDTDLSSGLLYERKAFTLLAATEDRNEGI 245 Query: 288 AAFAEKRKPLYTG 300 AF EKRKPL+ G Sbjct: 246 NAFLEKRKPLFKG 258 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 259 Length adjustment: 26 Effective length of query: 275 Effective length of database: 233 Effective search space: 64075 Effective search space used: 64075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory