Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_019621628.1 G329_RS0108885 acyl-CoA dehydrogenase family protein
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_000381785.1:WP_019621628.1 Length = 385 Score = 198 bits (504), Expect = 2e-55 Identities = 134/382 (35%), Positives = 205/382 (53%), Gaps = 16/382 (4%) Query: 15 LDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQT-DPAIFR----EMGEVGLLGATI 69 +D TEE++M++D+A +FA+++LAP+ EA +QT D +I R ++ E+G +G I Sbjct: 1 MDLSFTEEQQMIQDAAKRFAENELAPQA-EAL--DQTKDRSILRGHCQQLAELGFMGLNI 57 Query: 70 PEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLA 129 YGG+ V + L EV + + MSV +++V I G++ QKQ+YLPK+ Sbjct: 58 DADYGGTEAGSVAFSLAVTEVAKACASTAVTMSV-TNMVAEVIQVVGSDEQKQQYLPKIC 116 Query: 130 SGEWI-GCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDDA 188 SGE++ G F LTE GSDP SM T+A K D G+ ++G+K WIT++ A VFVVWA DA Sbjct: 117 SGEYLSGSFCLTEAGAGSDPASMRTKAIKTDTGWAISGTKQWITSAEFAGVFVVWAVTDA 176 Query: 189 GDIRG-----FVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVR-GLK 242 +G F++ G++ K+G S T E+ D +P+ I ++ G + Sbjct: 177 EARKGKGITCFLVPADADGITIGPAEKKMGQHGSATNEVHFDACEIPDSAILGNLNEGFR 236 Query: 243 GPFTCLNSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEIT 302 T L R GI ALG A A YT +R+QFG+P+A Q +Q +AD TE+ Sbjct: 237 IAVTELAGGRIGIGSLALGIGLAAMEYAVAYTKERKQFGKPIADFQGLQWMMADRMTELE 296 Query: 303 LALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHL 362 A + K+ G + + S+ K + KA A +LGG G E+ + R Sbjct: 297 AARLLLMSAADRKERGLSYAKEASMAKLFASEKANQACYSALQLLGGYGYMQEYPLERMT 356 Query: 363 VNLEVVNTYEGTHDVHALILGR 384 ++ + + YEGT +V LI+ R Sbjct: 357 RDVRITSIYEGTSEVQRLIIAR 378 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 385 Length adjustment: 30 Effective length of query: 363 Effective length of database: 355 Effective search space: 128865 Effective search space used: 128865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory