Align ABC transporter for L-Lysine, permease component 2 (characterized)
to candidate WP_019621101.1 G329_RS0106200 ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_09910 (229 letters) >NCBI__GCF_000381785.1:WP_019621101.1 Length = 249 Score = 271 bits (694), Expect = 6e-78 Identities = 134/216 (62%), Positives = 171/216 (79%) Query: 3 WDVIIKWLPKLAQGATLTLELVAIAVIAGLLLAIPLGIARSSRLWQVRALPYAYIFFFRG 62 WDVI ++LP+L +GA LTLELV ++ + G+ LA+PL + R+S V+A P+ YI+FFRG Sbjct: 5 WDVIWQYLPRLLEGAWLTLELVLVSGLIGIALAVPLALMRASSHSWVKAFPFIYIYFFRG 64 Query: 63 TPLLVQLFLVYYGLAQFDAVRSSALWPYLRDPFWCATVTMTLHTAAYIAEILRGAIQAIP 122 TPLLVQ+FLVYYG +QF+AVR S LWP L+ P+WCA + +L+TAAY AE+ R AIQAIP Sbjct: 65 TPLLVQIFLVYYGASQFEAVRESMLWPVLKQPYWCAIIAFSLNTAAYSAELFRSAIQAIP 124 Query: 123 KGEIEAARALGMSRPKALFYIMLPRAARIGLPAYSNEVILMLKASALASTVTLLELTGMA 182 GEIEAA A+GMS+P + I++PRA I LPAY NEVILMLK SALAST+TLL+LTGMA Sbjct: 125 TGEIEAAEAMGMSKPVQIRRIIMPRAFGIALPAYGNEVILMLKGSALASTITLLDLTGMA 184 Query: 183 RTIIARTYLPVEIFFAAGMFYLLMSFLLVQGFKQLE 218 RTIIARTY P+E+F AAGM YL +S L++ F+ +E Sbjct: 185 RTIIARTYTPLEMFLAAGMVYLAISALVIALFRFME 220 Lambda K H 0.331 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 249 Length adjustment: 23 Effective length of query: 206 Effective length of database: 226 Effective search space: 46556 Effective search space used: 46556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory