Align Histidine transport system permease protein HisM (characterized)
to candidate WP_019621102.1 G329_RS0106205 ABC transporter permease
Query= SwissProt::P0A2I7 (235 letters) >NCBI__GCF_000381785.1:WP_019621102.1 Length = 230 Score = 97.4 bits (241), Expect = 2e-25 Identities = 61/196 (31%), Positives = 109/196 (55%), Gaps = 2/196 (1%) Query: 21 TGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTP-LYVQLLVFY 79 +G IT+ L +SS+++G ++ ++ A ++S N+ R+ +T + RG P L + L +++ Sbjct: 12 SGTWITIQLALSSLLVGLVIGLLGASAKLSKNRLARWLGTAYTTLVRGLPELLLVLTIYF 71 Query: 80 SGMYTLEIVKGTDLLNAFFRSG-LNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARA 138 G L + G + + G V AL++ AY TE+F A+ +P G+ E+ A Sbjct: 72 GGSQLLMWIAGFFGYDEYIEIGPFVAGVAALSIAFGAYATEVFRMAMMEIPKGQWESGLA 131 Query: 139 YGFSSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQ 198 G S + + IILP R+A+P N ++L TAL + D+++ ++ SAT + Sbjct: 132 CGMSPLRTFFRIILPQVWRLAIPGLGNLFQVLLKDTALVSVVGLNDIMRQSQVAISATKE 191 Query: 199 PFTAFGIAAVLYLLIS 214 PFT F +AA++YLL++ Sbjct: 192 PFTFFLVAALIYLLLT 207 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 230 Length adjustment: 23 Effective length of query: 212 Effective length of database: 207 Effective search space: 43884 Effective search space used: 43884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory