Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate WP_019620367.1 G329_RS0102470 beta-ketothiolase BktB
Query= SwissProt::Q8VPF1 (401 letters) >NCBI__GCF_000381785.1:WP_019620367.1 Length = 394 Score = 299 bits (765), Expect = 1e-85 Identities = 177/399 (44%), Positives = 240/399 (60%), Gaps = 8/399 (2%) Query: 3 REVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQAG 62 REV + VRT IG FGGSL + +LA V V R+ V+ + Sbjct: 4 REVVVLSGVRTAIGGFGGSLKSQTPCELATTCVSEAVSRSGAAAEDFGHSVFGNVIHTER 63 Query: 63 EDNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVESMS 122 D + R+A + GLP PGVT+NRLC SG+ A+ +A + I G + +AGG E MS Sbjct: 64 RD-MYLGRVAAVNGGLPHETPGVTINRLCGSGLQAIISATQQIELGVCDAAVAGGSEVMS 122 Query: 123 RAPYVMGKADSAFGRGQKIEDTTIGWRFINPLMKAQYGVDAMPETADNVADDYKVSRADQ 182 ++ Y M A GQ++ D I + L + M TA+N+AD ++VSR DQ Sbjct: 123 KSQYWMPTARF----GQRMGDGAIVDAMVGALT-CPFDDTHMGITAENIADKWQVSREDQ 177 Query: 183 DAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKGETVVDADEHLRPDTTLEALAKLKPVN 242 DA A+ S A RA G F E+IVP+ +K +KG TV D DEHLR T + KL+P Sbjct: 178 DALAVMSHNNAERAITEGRFKEQIVPIELKSRKGVTVFDTDEHLRYGCTTADMEKLRPAF 237 Query: 243 GPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAKVLGMASAGVAPRVMGIGPVPA 302 D +VTAGNASG+ND + A+ L +AE + GLK A+++G + AGV P+ MGIGPVPA Sbjct: 238 KRDGSVTAGNASGLNDAAAAVTLMAAETAEAKGLKPMARLVGYSFAGVEPKYMGIGPVPA 297 Query: 303 VRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELGIADDDARVNPNGGAIALGHPLGAS 362 VRKLL LS+ D DV E+NEAFAAQ LAV R+L + + +VN NG I+LGHP+GA+ Sbjct: 298 VRKLLADAELSIGDIDVWEVNEAFAAQALAVCRDLELPLE--KVNVNGSGISLGHPIGAT 355 Query: 363 GARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVERV 401 GA + + A+H+L++SGG+ + TMC+G GQG+A ERV Sbjct: 356 GAIITVKALHELQRSGGRYAVVTMCIGGGQGIAALFERV 394 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 394 Length adjustment: 31 Effective length of query: 370 Effective length of database: 363 Effective search space: 134310 Effective search space used: 134310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory