Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_019620367.1 G329_RS0102470 beta-ketothiolase BktB
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_000381785.1:WP_019620367.1 Length = 394 Score = 295 bits (754), Expect = 2e-84 Identities = 178/400 (44%), Positives = 237/400 (59%), Gaps = 9/400 (2%) Query: 2 REAFICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQAG 61 RE + G+RT IG +GG+L S +LA + E + R+ AE + G Sbjct: 4 REVVVLSGVRTAIGGFGGSLKSQTPCELATTCVSEAVSRSGAA-AEDFGHSVFGNVIHTE 62 Query: 62 EDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESMS 121 + + R+A + GLP G TINRLCGSGL A+ A + I+ G D +AGG E MS Sbjct: 63 RRDMYLGRVAAVNGGLPHETPGVTINRLCGSGLQAIISATQQIELGVCDAAVAGGSEVMS 122 Query: 122 RAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISREDQ 181 ++ + M A M D I V L F M TAEN+A+ ++SREDQ Sbjct: 123 KSQYWMPTARFG----QRMGDGAIVDAMVGALTCP-FDDTHMGITAENIADKWQVSREDQ 177 Query: 182 DSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKAP 241 D+ A+ S +A + G E+IVP+ LK++KGV T DEHLR T + L+ Sbjct: 178 DALAVMSHNNAERAITEGRFKEQIVPIELKSRKGV-TVFDTDEHLRYGCTTADMEKLRPA 236 Query: 242 FRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPVP 301 F+ +G +TAGNASG+ND AAA+ + + + A A+GL P AR+V + AGVEP+ MG+GPVP Sbjct: 237 FKRDGSVTAGNASGLNDAAAAVTLMAAETAEAKGLKPMARLVGYSFAGVEPKYMGIGPVP 296 Query: 302 ATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLGM 361 A R++L A LSI D+DV E+NEAFAAQAL V R+L LP VN NG I+LGHP+G Sbjct: 297 AVRKLLADAELSIGDIDVWEVNEAFAAQALAVCRDLELP--LEKVNVNGSGISLGHPIGA 354 Query: 362 SGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV 401 +GA + + A HEL R GRYA+ TMCIG GQGIA + ERV Sbjct: 355 TGAIITVKALHELQRSGGRYAVVTMCIGGGQGIAALFERV 394 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 394 Length adjustment: 31 Effective length of query: 370 Effective length of database: 363 Effective search space: 134310 Effective search space used: 134310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory