Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_019620489.1 G329_RS0103095 aldehyde dehydrogenase
Query= metacyc::MONOMER-16244 (495 letters) >NCBI__GCF_000381785.1:WP_019620489.1 Length = 494 Score = 371 bits (952), Expect = e-107 Identities = 211/477 (44%), Positives = 272/477 (57%), Gaps = 10/477 (2%) Query: 24 FINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSS-WSTSDPQV 82 +IN F + S TF ++P+TE+ + V D+D AV A F S WS P+ Sbjct: 21 YINGGFQAAVSGDTFPCINPATEKLLADVASCDQADVDIAVANAREVFKSGVWSEIPPRE 80 Query: 83 RMKVLYKLADLIDEHADTLAHIEALDNGKSLMCSKGDVALTAAYFRSCAGWT----DKIK 138 R K + K A+LI++H D A ++ LD GKS+ V + C WT DKI Sbjct: 81 RKKAMQKWANLIEQHQDEFALLDTLDMGKSI---SEMVNIDVPDAIDCIRWTAESIDKIY 137 Query: 139 GSVIETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLS 198 G + TGD +P+GV G I PWN+PLLM SWK+ P L G + +LK +E +PLS Sbjct: 138 GEIAPTGDDTLAMIHHQPVGVVGAITPWNYPLLMVSWKIAPALAAGNSVILKPSEKSPLS 197 Query: 199 ALYLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAES 258 AL LA L EAG P GV NV+ GFG TAG ++ H + +AFTGST +M A ES Sbjct: 198 ALRLAELAVEAGIPAGVFNVLPGFGHTAGKALALHMDVNVLAFTGSTRVAGMLMGYAGES 257 Query: 259 NLKKVTLELGGKSPNIVFDDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVS 318 N+K+V LE GGKSPN+VF DAD+K+ IF N GEVC A SR+YV + I ++ V+ Sbjct: 258 NMKRVWLEAGGKSPNLVFADADIKAAAAASAAAIFCNQGEVCIACSRLYVDKSIKEEFVA 317 Query: 319 EFKNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGG--ERFGNKG 376 AA S + GDP T MG QL + +YI ++EG VI GG E KG Sbjct: 318 ALVEAAASFQPGDPLDPATTMGPMVDGTQLAIVERYIRSAEEEGGQVIMGGVPEYQEGKG 377 Query: 377 YFIKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLST 436 +F KPTI V++EIFGPV+ + +F+T EE IALANDS YGL A V T NLS Sbjct: 378 FFAKPTIVDGAHNGMTFVKEEIFGPVLAVCEFETEEEAIALANDSVYGLGAAVWTQNLSR 437 Query: 437 AISVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAVRIGL 493 A VS K+ SG +WVNT+ + VPFGG SG GR+ AL+ YT +K V I L Sbjct: 438 AHRVSRKVESGMVWVNTWGEGDSTVPFGGVKASGNGRDKSLHALEKYTDIKNVLIRL 494 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 615 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 494 Length adjustment: 34 Effective length of query: 461 Effective length of database: 460 Effective search space: 212060 Effective search space used: 212060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory