Align Glycolate oxidase subunit GlcE; Glycolate dehydrogenase subunit GlcE; EC 1.1.99.14 (characterized)
to candidate WP_019621127.1 G329_RS0106335 glycolate oxidase subunit GlcE
Query= SwissProt::P52073 (350 letters) >NCBI__GCF_000381785.1:WP_019621127.1 Length = 370 Score = 334 bits (856), Expect = 2e-96 Identities = 178/351 (50%), Positives = 228/351 (64%), Gaps = 6/351 (1%) Query: 6 DYSQALLEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTLDVRCHRGIVNYDPTELVITA 65 D +Q+L QV QA ++ PLVI G SK F GRP+ G+TL + ++GIV+Y+P+ELVITA Sbjct: 20 DQAQSLANQVEQAFVNQQPLVICGGGSKRFYGRPLEGETLSLSDYQGIVSYEPSELVITA 79 Query: 66 RVGTPLVTIEAALESAGQMLPCEPPHYGEEATWGGMVACGLAGPRRPWSGSVRDFVLGTR 125 R GTPL IE L GQML EPPHY + AT GG +ACGL+GPRRP+SG+ RDFVLG Sbjct: 80 RAGTPLQVIETVLAEQGQMLGFEPPHYADNATLGGTIACGLSGPRRPYSGAARDFVLGVT 139 Query: 126 IITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEISMKVLPRPRASLSLRREIS 185 +I G G+ LRFGG+VMKNVAGYD+SRLM G+ G LGVL EIS+KV+P P + S Sbjct: 140 MINGKGEILRFGGQVMKNVAGYDVSRLMSGAQGTLGVLLEISLKVIPMPAHEETRVLSCS 199 Query: 186 LQEAMSEIAEWQLQPLPISGLCYFDNALWIRLEGGEGSVKAARELLGGEEVA-GQFWQQL 244 Q+ + + + QPLPIS + ++ L+IRL G V +A +++GGE ++ QFW Q Sbjct: 200 QQQMQTLLCDLGRQPLPISATLFHNDQLYIRLSGATAGVHSAAQIIGGERLSTDQFWLQA 259 Query: 245 REQQLPFFSLPGTLWRISLPSDAPMMD--LPGEQLIDWGGALRWLKSTAEDNQIHRIARN 302 +EQQ PFF WR+SLP A + L QLI+WGGA RWL S A+ QI + A Sbjct: 260 KEQQHPFFHPAQPCWRLSLPPAAAAVPDALARHQLIEWGGAQRWLYSEADPCQIIQWAEA 319 Query: 303 AGGHATRFSAGDGG---FAPLSAPLFRYHQQLKQQLDPCGVFNPGRMYAEL 350 GGHAT + G F PLS L Q++KQ DP G+ NPGR+Y EL Sbjct: 320 NGGHATAVDRSEPGHTLFHPLSNALLPLTQRIKQSFDPAGILNPGRLYTEL 370 Lambda K H 0.320 0.138 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 370 Length adjustment: 29 Effective length of query: 321 Effective length of database: 341 Effective search space: 109461 Effective search space used: 109461 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory