Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate WP_019620489.1 G329_RS0103095 aldehyde dehydrogenase
Query= BRENDA::P42412 (487 letters) >NCBI__GCF_000381785.1:WP_019620489.1 Length = 494 Score = 244 bits (624), Expect = 4e-69 Identities = 157/481 (32%), Positives = 251/481 (52%), Gaps = 18/481 (3%) Query: 10 YINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKT--WSKVAVPR 67 YING + + + +NPAT+++L V + D+D A A E FK+ WS++ Sbjct: 21 YINGGFQAAVSGDTFPCINPATEKLLADVASCDQADVDIAVANAREVFKSGVWSEIPPRE 80 Query: 68 RARILFNFQQLLSQHKEELAHLITIENGKNTKEALG-EVGRGIENVEFAAGAPSLMMGDS 126 R + + + L+ QH++E A L T++ GK+ E + +V I+ + + A + + G+ Sbjct: 81 RKKAMQKWANLIEQHQDEFALLDTLDMGKSISEMVNIDVPDAIDCIRWTAESIDKIYGE- 139 Query: 127 LASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTE 186 +A D A + P+GVVG I P+N+P+++ W A+A GN+ ILKPSE++PL Sbjct: 140 IAPTGDDTLAMIHHQPVGVVGAITPWNYPLLMVSWKIAPALAAGNSVILKPSEKSPLSAL 199 Query: 187 KLVELFEKAGLPKGVFNVVYG-AHDVVNGILEHPEIKAISFVGSKPV-GEYVYKKGSENL 244 +L EL +AG+P GVFNV+ G H + H ++ ++F GS V G + G N+ Sbjct: 200 RLAELAVEAGIPAGVFNVLPGFGHTAGKALALHMDVNVLAFTGSTRVAGMLMGYAGESNM 259 Query: 245 KRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKL 304 KRV G K+ +V DA+++ A F + GE C+AC+ + V++ I +EF+A L Sbjct: 260 KRVWLEAGGKSPNLVFADADIKAAAAASAAAIFCNQGEVCIACSRLYVDKSIKEEFVAAL 319 Query: 305 QEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDG-RENVSDDGYF 363 E A + G+ LD +GP++ YI EEG +++ G E G+F Sbjct: 320 VEAAASFQPGDPLDPATTMGPMVDGTQLAIVERYIRSAEEEGGQVIMGGVPEYQEGKGFF 379 Query: 364 VGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIR 423 PTI D MT K+EIF PVL+V + +EAI +AN S + GA ++T N + Sbjct: 380 AKPTIVDGAHNGMTFVKEEIFGPVLAVCEFETEEEAIALANDSVYGLGAAVWTQNLSRAH 439 Query: 424 YFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKD----SVDFYTRKKVVTA 479 +++GM+ +N + PF G K+S NG+D +++ YT K V Sbjct: 440 RVSRKVESGMVWVNTWGEGD-STVPFGGVKAS------GNGRDKSLHALEKYTDIKNVLI 492 Query: 480 R 480 R Sbjct: 493 R 493 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 563 Number of extensions: 33 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 494 Length adjustment: 34 Effective length of query: 453 Effective length of database: 460 Effective search space: 208380 Effective search space used: 208380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory