Align aminomuconate-semialdehyde dehydrogenase (EC 1.2.1.32) (characterized)
to candidate WP_019620489.1 G329_RS0103095 aldehyde dehydrogenase
Query= BRENDA::Q83XU8 (485 letters) >NCBI__GCF_000381785.1:WP_019620489.1 Length = 494 Score = 324 bits (831), Expect = 4e-93 Identities = 184/464 (39%), Positives = 264/464 (56%), Gaps = 10/464 (2%) Query: 24 SPLNNAVIAKVHEAGRAEVDAAVAAAQAALK-GAWGRMSLAQRVEVLYAVADGINRRFDD 82 +P ++A V +A+VD AVA A+ K G W + +R + + A+ I + D+ Sbjct: 39 NPATEKLLADVASCDQADVDIAVANAREVFKSGVWSEIPPRERKKAMQKWANLIEQHQDE 98 Query: 83 FLAAEVEDTGKPMSLARHVDIPRGAANFKIFADVVKNVPTEFFEMPTPDGVGAINYAVRR 142 F + D GK +S ++D+P + A+ + + E P G + + Sbjct: 99 FALLDTLDMGKSISEMVNIDVPDAIDCIRWTAESIDKIYGEI----APTGDDTLAMIHHQ 154 Query: 143 PVGVVGVICPWNLPLLLMTWKVGPALACGNTVVVKPSEETPQTAALLGEVMNTAGVPPGV 202 PVGVVG I PWN PLL+++WK+ PALA GN+V++KPSE++P +A L E+ AG+P GV Sbjct: 155 PVGVVGAITPWNYPLLMVSWKIAPALAAGNSVILKPSEKSPLSALRLAELAVEAGIPAGV 214 Query: 203 YNVVHGFGPNSTGEFLTSHPDVNAITFTGETGTGEAIMKAAADG-ARPVSLELGGKNAAI 261 +NV+ GFG ++ G+ L H DVN + FTG T +M A + + V LE GGK+ + Sbjct: 215 FNVLPGFG-HTAGKALALHMDVNVLAFTGSTRVAGMLMGYAGESNMKRVWLEAGGKSPNL 273 Query: 262 VFADCDLDKAIEGTLRSCFANCGQVCLGTERVYVERPIFDRFVSRLKKGAEGMQLGRPED 321 VFAD D+ A + + F N G+VC+ R+YV++ I + FV+ L + A Q G P D Sbjct: 274 VFADADIKAAAAASAAAIFCNQGEVCIACSRLYVDKSIKEEFVAALVEAAASFQPGDPLD 333 Query: 322 LATGMGPLISQEHREKVLSYYKKAVEAGATVVTGGGVPEMPEALKGGAWVQPTIWTGLGD 381 AT MGP++ V Y + A E G V+ GG VPE E G + +PTI G + Sbjct: 334 PATTMGPMVDGTQLAIVERYIRSAEEEGGQVIMGG-VPEYQEGK--GFFAKPTIVDGAHN 390 Query: 382 DSVVAREEIFGPCALVMPFDSEEEVIRRANDNDYGLARRIWTTNLSRAHRVAGAIEVGIA 441 +EEIFGP V F++EEE I AND+ YGL +WT NLSRAHRV+ +E G+ Sbjct: 391 GMTFVKEEIFGPVLAVCEFETEEEAIALANDSVYGLGAAVWTQNLSRAHRVSRKVESGMV 450 Query: 442 WVNSWFLRDLRTAFGGSKQSGIGREGGVHSLEFYTELKNVCIKL 485 WVN+W D FGG K SG GR+ +H+LE YT++KNV I+L Sbjct: 451 WVNTWGEGDSTVPFGGVKASGNGRDKSLHALEKYTDIKNVLIRL 494 Lambda K H 0.318 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 494 Length adjustment: 34 Effective length of query: 451 Effective length of database: 460 Effective search space: 207460 Effective search space used: 207460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory