GapMind for catabolism of small carbon sources

 

Protein WP_000942251.1 in Streptococcus oralis 7747

Annotation: NCBI__GCF_000382825.1:WP_000942251.1

Length: 254 amino acids

Source: GCF_000382825.1 in NCBI

Candidate for 21 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 54% 91% 257.7 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-aspartate catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 54% 91% 257.7 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-glutamate catabolism gltL med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 54% 91% 257.7 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 50% 100% 254.2 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 51% 93% 245 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-histidine catabolism bgtA med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 50% 97% 243 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-lysine catabolism hisP med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 50% 97% 243 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
D-alanine catabolism Pf6N2E2_5405 med ABC transporter for D-Alanine, ATPase component (characterized) 51% 94% 240.7 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 50% 93% 240 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 50% 93% 240 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 50% 93% 240 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 50% 93% 240 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 50% 93% 240 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-histidine catabolism hisP med histidine transport ATP-binding protein hisP (characterized) 51% 96% 238.4 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-citrulline catabolism AO353_03040 med ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 49% 99% 236.9 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 48% 94% 233 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
D-glucosamine (chitosamine) catabolism AO353_21725 med ABC transporter for D-Glucosamine, putative ATPase component (characterized) 48% 94% 232.3 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-citrulline catabolism PS417_17605 med ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 50% 91% 226.1 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 40% 58% 177.6 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 39% 72% 176.4 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 35% 86% 144.8 TcyC (YckI), component of Uptake system for L-cystine 56% 270.0

Sequence Analysis Tools

View WP_000942251.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLQVEHIAKTFGERQVLEDVNLQVNQGDVVVILGPSGSGKTTFLRCLNHLEKADSGRLTL
AGKTYDLAKLSKKDILEIRQKTAFVFQHYNLFANKTALENILEGLIVARKVPKEEALKRA
ESALEKVGLLAYKDYYPSQLSGGQQQRIGIARAIAVKPEVILLDEPTSALDPELVGDVLD
VLKQLAGEGVTMVVVTHEMGFARDVANHVIFMDGGRIVEENNPHDFFSRPQEERTKQFLA
RILSDASYSVEYMI

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory