Protein WP_025168401.1 in Streptococcus oralis 7747
Annotation: NCBI__GCF_000382825.1:WP_025168401.1
Length: 727 amino acids
Source: GCF_000382825.1 in NCBI
Candidate for 29 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| D-maltose catabolism | malEIICBA | hi | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) (characterized) | 70% | 100% | 1020.4 | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 | 36% | 394.0 |
| D-maltose catabolism | malEIICB | hi | The Maltose group translocator, MalT of 470 aas and 10 TMSs. Takes up extracellular maltose, releasing maltose-phosphate into the cytoplasm (characterized) | 63% | 100% | 695.7 | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 | 36% | 394.0 |
| N-acetyl-D-glucosamine catabolism | nagEIIA | med | Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale) | 50% | 88% | 147.1 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucosamine (chitosamine) catabolism | nagEIIA | med | Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale) | 50% | 88% | 147.1 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-maltose catabolism | malEIIA | med | Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale) | 50% | 88% | 147.1 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| trehalose catabolism | treEIIA | med | Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale) | 50% | 88% | 147.1 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-cellobiose catabolism | ptsG-crr | lo | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 (characterized) | 36% | 96% | 394 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucose catabolism | ptsG-crr | lo | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 (characterized) | 36% | 96% | 394 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| lactose catabolism | ptsG-crr | lo | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 (characterized) | 36% | 96% | 394 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-maltose catabolism | ptsG-crr | lo | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 (characterized) | 36% | 96% | 394 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| sucrose catabolism | ptsG-crr | lo | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 (characterized) | 36% | 96% | 394 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| trehalose catabolism | ptsG-crr | lo | PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 (characterized) | 36% | 96% | 394 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucosamine (chitosamine) catabolism | gamP | lo | Putative PTS system glucosamine-specific EIICBA component; EC 2.7.1.193 (characterized) | 35% | 100% | 372.9 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| N-acetyl-D-glucosamine catabolism | nagEcba | lo | protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized) | 34% | 92% | 295.8 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucosamine (chitosamine) catabolism | nagEcba | lo | protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized) | 34% | 92% | 295.8 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| N-acetyl-D-glucosamine catabolism | nagEcb | lo | N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized) | 30% | 81% | 191 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucosamine (chitosamine) catabolism | nagEcb | lo | N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized) | 30% | 81% | 191 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-cellobiose catabolism | crr | lo | glucose-specific phosphotransferase enzyme IIA component; EC 2.7.1.- (characterized) | 35% | 97% | 116.7 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucose catabolism | crr | lo | glucose-specific phosphotransferase enzyme IIA component; EC 2.7.1.- (characterized) | 35% | 97% | 116.7 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| lactose catabolism | crr | lo | glucose-specific phosphotransferase enzyme IIA component; EC 2.7.1.- (characterized) | 35% | 97% | 116.7 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-maltose catabolism | crr | lo | glucose-specific phosphotransferase enzyme IIA component; EC 2.7.1.- (characterized) | 35% | 97% | 116.7 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| sucrose catabolism | crr | lo | glucose-specific phosphotransferase enzyme IIA component; EC 2.7.1.- (characterized) | 35% | 97% | 116.7 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| trehalose catabolism | crr | lo | glucose-specific phosphotransferase enzyme IIA component; EC 2.7.1.- (characterized) | 35% | 97% | 116.7 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| N-acetyl-D-glucosamine catabolism | nagPcb | lo | PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized) | 32% | 50% | 112.1 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucosamine (chitosamine) catabolism | nagPcb | lo | PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized) | 32% | 50% | 112.1 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| N-acetyl-D-glucosamine catabolism | crr | lo | Putative PTS system sugar phosphotransferase component IIA (characterized, see rationale) | 36% | 93% | 82.4 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucosamine (chitosamine) catabolism | crr | lo | Putative PTS system sugar phosphotransferase component IIA (characterized, see rationale) | 36% | 93% | 82.4 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| N-acetyl-D-glucosamine catabolism | ptsB | lo | IIB aka PtsB, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) (characterized) | 40% | 93% | 61.6 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
| D-glucosamine (chitosamine) catabolism | ptsB | lo | IIB aka PtsB, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) (characterized) | 40% | 93% | 61.6 | The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) | 70% | 1020.4 |
Sequence Analysis Tools
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MKATFKNVLSFEFWQKFGKALMVVIAVMPAAGLMISIGKSIVMIDPNLAPLVITGGILEQ
IGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRITGTIFGVTSDMLKNPEAM
VTTLFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAYNKYYNYRKLPDALSFFNG
KRFVPFVVILRSAIAAIVLAAFWPVVQTGINSFGIWIANSQETAPILAPFLYGTLERLLL
PFGLHHMLTIPMNYTALGGTYEILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASHYQQ
LLDTVHPARFKVGQMIGSFGILMGVIVAIYRNVDADKKHQYKGMMIATALATFLTGVTEP
IEYMFMFIATPLYLVYALVQGAAFAMADIVHLRMHSFGSIEFLTRTPLAINAGIGMDIVN
FIWVTVLFAVIMYFIANFMIKKFNYATPGRNGNYETAEGASEDAASGETKVAAASQAVNI
INLLGGRANIVDVDACMTRLRVTVKDADRVGTEEQWKAEGAMGLVMKGQGVQAIYGPKAD
VLKSDIQDILDSGEVIPETLPSQMTEVQKNTVHFKGVTEEVYSVADGQVIALEQVKDPVF
AQKMMGDGFAVEPANGNIVSPVTGTVSSIFPTKHALGLVTESGLEVLVHIGLDTVSLEGK
PFTVHVSEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDVLKSVKLEQTGSLAAKT
AVAKVEL
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory