Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_038806275.1 HK29_RS06670 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_000382825.1:WP_038806275.1 Length = 244 Score = 125 bits (314), Expect = 8e-34 Identities = 78/253 (30%), Positives = 133/253 (52%), Gaps = 18/253 (7%) Query: 11 LLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIF 70 L+ L KSFG + ++ +E+ +G + +IGP+G+GK+TL ++ +G+VIF Sbjct: 5 LIKIEELHKSFGKNEVLKGINLEIKRGEVVVIIGPSGSGKSTLLRSMNLLEEASRGKVIF 64 Query: 71 DGEPIQQLQPHQIA-QQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQPQVV 129 +G I + A ++ M FQ ++V+EN+ L+ K GE+ Sbjct: 65 EGVDITDKKNDLFAMREKMGMVFQQFNLFPNMTVMENITLSPIKTKGES----------- 113 Query: 130 VKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEPAAG 189 ++ +++A LLE VGL KA Y LSGGQ++ + + R L P ++L DEP + Sbjct: 114 ---KEVAEKRAQELLEKVGLPDKATAYPQSLSGGQQQRIAIARGLAMEPDVLLFDEPTSA 170 Query: 190 VNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPAEI-- 247 ++P ++ ++ ++ + GMT +I+ H M + DRV +A+G + DGTP EI Sbjct: 171 LDPEMVGEVL-AVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMADGVVVEDGTPEEIFD 229 Query: 248 QTNSQVLEAYLGK 260 QT Q + +L K Sbjct: 230 QTKEQRTKEFLSK 242 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 244 Length adjustment: 24 Effective length of query: 236 Effective length of database: 220 Effective search space: 51920 Effective search space used: 51920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory