Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_038806392.1 HK29_RS07850 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >NCBI__GCF_000382825.1:WP_038806392.1 Length = 243 Score = 130 bits (327), Expect = 3e-35 Identities = 92/251 (36%), Positives = 137/251 (54%), Gaps = 9/251 (3%) Query: 18 RLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEKVAAHWRDQGADVVAIKA 77 +L NK V +TG+++GIG AI FA A ++++ +GE E++ A + + G VV I Sbjct: 2 QLTNKNVFVTGSSRGIGLAIAHKFAQLGANVVLNS-RGEISEELLAEFSNYGVKVVPISG 60 Query: 78 DVSRQQDLHAMARLAIDLHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGC 137 DVS D M AI G +DVLVN AG+ L+MTE+D+ + I+L GA+ Sbjct: 61 DVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEQDFEKVIKINLTGAFNMT 120 Query: 138 KAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNA 197 +AVL QMI+ G+IIN++S G Y +K GL+G T+++ E A + VRVNA Sbjct: 121 QAVLKQMIKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVANRNVRVNA 180 Query: 198 IAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFINA 257 +APG IE+ + +D E A P + GQ +A T VFLA + ++ Sbjct: 181 LAPGMIESDMTA----VLSDKVKEATLA--QIPMKHFGQAEHIADTTVFLAGQD--YLTG 232 Query: 258 SCITIDGGRSV 268 + +DGG S+ Sbjct: 233 QVLAVDGGLSM 243 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 243 Length adjustment: 24 Effective length of query: 248 Effective length of database: 219 Effective search space: 54312 Effective search space used: 54312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory