Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_038805714.1 HK29_RS00255 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9HU32 (257 letters) >NCBI__GCF_000382825.1:WP_038805714.1 Length = 252 Score = 232 bits (592), Expect = 5e-66 Identities = 114/247 (46%), Positives = 167/247 (67%), Gaps = 11/247 (4%) Query: 8 LEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQILVS 67 LEI++L K +GD +L+G+SL + G+V+ ILG SG GKST LRC+N LE G IL+ Sbjct: 6 LEIKDLKKSFGDNPILQGLSLDIKKGEVVVILGPSGCGKSTLLRCLNGLETIQGGDILLD 65 Query: 68 GEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVLGKSK 127 G+ + + + + +R ++G VFQ++ L+PH+ +L N+I P + + K Sbjct: 66 GQS-----------IIGNQKDFHLVRQKIGMVFQSYELFPHLDVLQNLILGPIKAQDRDK 114 Query: 128 AEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSALDPE 187 E E A LL +VG+ DK+H + QLSGGQ+QR AI R L M P++ILFDE T++LDPE Sbjct: 115 KEVTEEALQLLERVGLLDKKHGFARQLSGGQKQRVAIVRALLMHPEIILFDEVTASLDPE 174 Query: 188 MVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFENPQSA 247 MV+EVL +I LA+EGRTM+LVTHEM FA+ ++ ++FL QG + E+GT Q+ F NPQ+ Sbjct: 175 MVREVLELINDLAQEGRTMILVTHEMQFAQAIADRIIFLDQGKIAEEGTAQEFFTNPQTK 234 Query: 248 RCKQFMS 254 R ++F++ Sbjct: 235 RAQEFLN 241 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 252 Length adjustment: 24 Effective length of query: 233 Effective length of database: 228 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory