Align L-asparagine permease; L-asparagine transport protein (characterized)
to candidate WP_038805943.1 HK29_RS02745 amino acid permease
Query= SwissProt::P77610 (499 letters) >NCBI__GCF_000382825.1:WP_038805943.1 Length = 445 Score = 265 bits (676), Expect = 3e-75 Identities = 142/420 (33%), Positives = 241/420 (57%), Gaps = 14/420 (3%) Query: 28 KAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLICGLFSFFILRALGELVLH 87 + + NR VQ++AI G IGTGLFLGAG + + GP++ L+Y+I G F F ++RA+GE++ Sbjct: 3 RGLTNRHVQVMAIAGTIGTGLFLGAGRSISLTGPSIILIYMITGAFMFLMMRAVGEMLYQ 62 Query: 88 RPSSGSFVSYAREFLGEKAAYVAGWMYFINWAMTGIVDITAVALYMHYWGAFGGVPQWVF 147 P +F+++ LG+ Y + W Y+++ G+ +ITA++ Y+ +W F P W+ Sbjct: 63 DPEQHTFINFITRHLGKGWGYFSVWSYWLSVVFIGMAEITAISHYVQFW--FPSWPSWLI 120 Query: 148 ALAALTIVGTMNMIGVKWFAEMEFWFALIKVLAIVTFLVVGTVFLGSGQPLDGNTTGFHL 207 + LTI+ +N+I VK F E+EFWFA++K++AI+ + G + +G T Sbjct: 121 QIVFLTILALVNLIAVKLFGEVEFWFAMVKIVAILAMIATGAFMVLTGFETSHGTASLAN 180 Query: 208 ITDNGGFFPHGLLPALVLIQGVVFAFASIEMVGTAAGECKDPQTMVPKAINSVIWRIGLF 267 I+D FP+G++ ++ Q V FA+ IE +G E K+P+ ++PKA+ + RI F Sbjct: 181 ISDQFSLFPNGVMNFVMAFQMVFFAYLMIEFIGVTTSETKNPRQVLPKAVKEIPLRIVFF 240 Query: 268 YVGSVVLLVMLLPWSAYQAGQSPFVTFFSKLGVPYIGSIMNIVVLTAALSSLNSGLYCTG 327 Y G+++ ++ ++PW + SPFVT F G+ + +++N VVLT+A S+LNS LY TG Sbjct: 241 YGGALLAIMSIIPWRELASSDSPFVTVFELAGIKWAAALINFVVLTSAASALNSTLYSTG 300 Query: 328 RILRSMAMGGSAPSFMAK------MSRQHVPYAGILATLVVYVVGVFLNYLV-PSRVFEI 380 R L +A +P+ K +SR +VP I+A+ ++ + F+N L S F + Sbjct: 301 RHLYQIA--HDSPNRFLKAIKADTLSRHNVPQNAIIASAILIALAAFINVLPGVSDAFAL 358 Query: 381 VLNFASLGIIASWAFIIVCQMRLRKAIKEGKAADVSFKLPGAPFTSWLTLLFLLSVLVLM 440 + +S IA + I+V ++ RK+ + AD + +P + LT+LF + V + Sbjct: 359 ITASSSGVYIAIYILIMVAHLKYRKS--QDFMAD-GYLMPQYRLLNPLTILFFIFVFATL 415 Lambda K H 0.327 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 651 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 445 Length adjustment: 33 Effective length of query: 466 Effective length of database: 412 Effective search space: 191992 Effective search space used: 191992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory