Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_038806275.1 HK29_RS06670 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_000382825.1:WP_038806275.1 Length = 244 Score = 241 bits (615), Expect = 1e-68 Identities = 126/250 (50%), Positives = 178/250 (71%), Gaps = 12/250 (4%) Query: 27 LQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLD 86 +++E +HK +G++EVLKG++L ++G+V+ +IG SGSGKST+LR +N LE+ G + + Sbjct: 6 IKIEELHKSFGKNEVLKGINLEIKRGEVVVIIGPSGSGKSTLLRSMNLLEEASRGKVIFE 65 Query: 87 GISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAA 146 G+ I ++ + L +R ++ MVFQ FNL+ +MTV+ENIT++P + S Sbjct: 66 GVDITDKK----------NDLFAMREKMGMVFQQFNLFPNMTVMENITLSPIKTKGESKE 115 Query: 147 EAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPE 206 AEKRA+ L+KVGLP + A YP LSGGQQQR+AIAR LAMEP+++LFDEPTSALDPE Sbjct: 116 VAEKRAQELLEKVGLPDK-ATAYPQSLSGGQQQRIAIARGLAMEPDVLLFDEPTSALDPE 174 Query: 207 LVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHG-DARILDQPNSE 265 +VGEVL V+Q LA+ G TM++VTHEMGFAR+V+ +V+F+ G V E G I DQ + Sbjct: 175 MVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMADGVVVEDGTPEEIFDQTKEQ 234 Query: 266 RLQQFLSNRL 275 R ++FLS L Sbjct: 235 RTKEFLSKIL 244 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 244 Length adjustment: 24 Effective length of query: 252 Effective length of database: 220 Effective search space: 55440 Effective search space used: 55440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory