Align RnsD, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized)
to candidate WP_038806022.1 HK29_RS04005 ABC transporter permease
Query= TCDB::Q8DU39 (318 letters) >NCBI__GCF_000382825.1:WP_038806022.1 Length = 318 Score = 518 bits (1334), Expect = e-152 Identities = 252/318 (79%), Positives = 288/318 (90%) Query: 1 MSLENMLALLISSMLVYATPLIFTSIGGVFSERSGVVNVGLEGIMVMGAFAGVVFNIEFA 60 MS+ +L LL+SSML+Y+ PLIFTSIGGVFSER GVVNVGLEGIMVMGAF+GVVFN+EFA Sbjct: 1 MSITTLLTLLVSSMLIYSAPLIFTSIGGVFSERGGVVNVGLEGIMVMGAFSGVVFNLEFA 60 Query: 61 HSFGKATPWIAALVGGLVGLLFSLLHALATINFRADHIVSGTVLNLLAPSLAVFFVKALY 120 G ATPW+A LV G+VG +FSL+HA+AT++FRADH+VSGTVLNL+AP+LAVF VK LY Sbjct: 61 EQLGSATPWLALLVAGVVGAIFSLIHAVATVHFRADHVVSGTVLNLMAPALAVFLVKVLY 120 Query: 121 NKGQTDNISQSFGKFDFPILSHIPFLGPIFFQGTSLVAYLAVLFSVFAWFILTKTKFGLR 180 NKGQTDN+SQ+FG+FDFP+L++IP +G IFF+ TSL+ Y+A+ FS FAWFIL KT+FGLR Sbjct: 121 NKGQTDNLSQTFGRFDFPVLANIPVIGDIFFKSTSLLGYIAIAFSFFAWFILFKTRFGLR 180 Query: 181 LRSVGEHPQAADTLGINVYLMRYLGVMISGLLGGIGGAIYAQSISVNFAGTTILGPGFIA 240 LRSVGEHPQAADTLGINVY MRYLGV+ISG LGGIGGAIYAQSISVNF+ TTI+GPGFIA Sbjct: 181 LRSVGEHPQAADTLGINVYKMRYLGVIISGFLGGIGGAIYAQSISVNFSVTTIVGPGFIA 240 Query: 241 LAAMIFGKWNPIGAMLSSLFFGLSQSLAVIGGQLPFLSKIPTVYLQIAPYALTILVLAVF 300 LAAMIFGKWNPIGAMLSSLFFGLSQSLAVIG QLPFL +P VYLQIAPY LT++VLA F Sbjct: 241 LAAMIFGKWNPIGAMLSSLFFGLSQSLAVIGSQLPFLQGVPAVYLQIAPYVLTVIVLAAF 300 Query: 301 FGQAVAPKADGINYIKSK 318 FG+AVAPKADGINYIKSK Sbjct: 301 FGKAVAPKADGINYIKSK 318 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 318 Length adjustment: 27 Effective length of query: 291 Effective length of database: 291 Effective search space: 84681 Effective search space used: 84681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory