Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_001000837.1 HK29_RS08500 SDR family oxidoreductase
Query= BRENDA::Q4J9F2 (255 letters) >NCBI__GCF_000382825.1:WP_001000837.1 Length = 266 Score = 118 bits (296), Expect = 1e-31 Identities = 87/269 (32%), Positives = 132/269 (49%), Gaps = 30/269 (11%) Query: 5 SLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVLGVKA 64 ++K K V+VTGA SGIG+AI ++ V +L ++ L +L VK Sbjct: 6 NIKGKTVLVTGASSGIGKAIVEELLELGVNVANFDLSDNDLRH---------PNLLFVKV 56 Query: 65 DVSKKKDVEEFVRRTFETYSRIDVLCNNAGI------MDGVTPVA--EVSDELWERVLAV 116 DV+ + +VEE V + E + ID + NNAGI +D P E+ DE +E+V + Sbjct: 57 DVTSRSEVEEGVAKIVERFGNIDAVVNNAGINIPRLLIDAENPKGPYELDDETFEKVTMI 116 Query: 117 NLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHY 176 N + S+AV I++K GKGVIVN AS AG+ G + Y K + TRS A Sbjct: 117 NQKGLYLVSQAVGRILVKNGKGVIVNMASEAGLEGSEGQSAYAATKAAVYSYTRSWAKEL 176 Query: 177 GDQGIRAVAVLPGTVKTNIGLGSSKPSELGMRTLTKLM--------SLSS----RLAEPE 224 G G+R V + PG ++ GL + E T K + S S+ R + Sbjct: 177 GKHGVRVVGIAPGIMEAT-GLRTLSYEEALAYTRGKTVEDIRAGYASTSTTPLGRSGKLR 235 Query: 225 DIANVIVFLASDEASFVNGDAVVVDGGLT 253 ++A+++ F SD +S++ G + GG T Sbjct: 236 EVADLVAFYISDRSSYITGVTTNIAGGKT 264 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 266 Length adjustment: 24 Effective length of query: 231 Effective length of database: 242 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory