Align ABC transporter related (characterized, see rationale)
to candidate WP_001075499.1 HK29_RS08215 amino acid ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000382825.1:WP_001075499.1 Length = 246 Score = 240 bits (613), Expect = 2e-68 Identities = 127/250 (50%), Positives = 175/250 (70%), Gaps = 12/250 (4%) Query: 9 LSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLA 68 L +K++ KS+G + VLK ISL H+G+VISI+G+SGSGKSTFLR +NLLETP +G + Sbjct: 6 LEIKHLKKSYGQNEVLKDISLSVHKGEVISIIGSSGSGKSTFLRSINLLETPTEGKILYR 65 Query: 69 GEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRSR 128 GE + K + R +LGMVFQ+FNL+ ++ VLEN I V KR R Sbjct: 66 GENVLAKGY-----------DLTHYREKLGMVFQSFNLFENLDVLENTIVAQTTVLKRER 114 Query: 129 AESVEEAEALLAKVGLAEKRGHY-PAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDP 187 +E+ + A+ L KVG+ E+ P LSGGQ+QRVAIARAL+M+P +LFDEPTSALDP Sbjct: 115 SEAEKIAKENLEKVGMGERYWQAKPKQLSGGQKQRVAIARALSMNPDAILFDEPTSALDP 174 Query: 188 ELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECKS 247 E+VGEVL++M+ LA+EG TM+VVTHEM FAR VS+RV+F+ +G + +G P+++F K Sbjct: 175 EMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEEGKPEDLFTNPKE 234 Query: 248 DRFRQFVSSH 257 +R R+F+ + Sbjct: 235 ERTREFLQRY 244 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 246 Length adjustment: 24 Effective length of query: 239 Effective length of database: 222 Effective search space: 53058 Effective search space used: 53058 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory