Align BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate WP_000942251.1 HK29_RS01475 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9RQ06 (407 letters) >NCBI__GCF_000382825.1:WP_000942251.1 Length = 254 Score = 175 bits (444), Expect = 1e-48 Identities = 100/264 (37%), Positives = 162/264 (61%), Gaps = 29/264 (10%) Query: 5 VKIEHLTKIFGKRIKTALTMVEQGEPKNEILKKTGATVGVYDTNFEINEGEIFVIMGLSG 64 +++EH+ K FG+R ++L+ D N ++N+G++ VI+G SG Sbjct: 2 LQVEHIAKTFGER---------------QVLE---------DVNLQVNQGDVVVILGPSG 37 Query: 65 SGKSTLLRLLNRLIEPTSGKIFIDDQ--DVATLNKEDLLQVRRKSMSMVFQNFGLFPHRT 122 SGK+T LR LN L + SG++ + + D+A L+K+D+L++R+K+ + VFQ++ LF ++T Sbjct: 38 SGKTTFLRCLNHLEKADSGRLTLAGKTYDLAKLSKKDILEIRQKT-AFVFQHYNLFANKT 96 Query: 123 ILENTEYGLEV-QNVPKEERRKRAEKALDNANLLDFKDQYPKQLSGGMQQRVGLARALAN 181 LEN GL V + VPKEE KRAE AL+ LL +KD YP QLSGG QQR+G+ARA+A Sbjct: 97 ALENILEGLIVARKVPKEEALKRAESALEKVGLLAYKDYYPSQLSGGQQQRIGIARAIAV 156 Query: 182 DPEILLMDEAFSALDPLIRREMQDELLELQAKFQKTIIFVSHDLNEALRIGDRIAIMKDG 241 PE++L+DE SALDP + ++ D L +L + T++ V+H++ A + + + M G Sbjct: 157 KPEVILLDEPTSALDPELVGDVLDVLKQLAGE-GVTMVVVTHEMGFARDVANHVIFMDGG 215 Query: 242 KIMQIGTGEEILTNPANDYVKTFV 265 +I++ + + P + K F+ Sbjct: 216 RIVEENNPHDFFSRPQEERTKQFL 239 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 10 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 254 Length adjustment: 28 Effective length of query: 379 Effective length of database: 226 Effective search space: 85654 Effective search space used: 85654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory