Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate WP_038805728.1 HK29_RS00330 ABC transporter permease/substrate-binding protein
Query= SwissProt::P14176 (354 letters) >NCBI__GCF_000382825.1:WP_038805728.1 Length = 506 Score = 110 bits (274), Expect = 1e-28 Identities = 62/189 (32%), Positives = 100/189 (52%), Gaps = 1/189 (0%) Query: 140 GAWSQAMVT-LALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVP 198 G W A+ L L L LL I I +PL ++L + A + + QT P+ L Sbjct: 13 GDWVTALSQHLQLSLLTLLLAIFIAVPLAVFLRYHEKMADWVLQIAGIFQTIPSLALLGL 72 Query: 199 IVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLP 258 + L GIG +P + +I+A+ PI++ TI G+ + L EA +FG + + L K ++P Sbjct: 73 FIPLMGIGTLPALTALVIYAIFPILQNTITGLKGIDPSLQEAGIAFGMTRWERLKKFEIP 132 Query: 259 LAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAI 318 LAMP IM+G+ +L + +A++I GGLG +L GI R + L +G + +LAI Sbjct: 133 LAMPVIMSGIRTAAVLIIGTATLAALIGAGGLGSFILLGIDRNNTSLILIGALSSAVLAI 192 Query: 319 ILDRLTQAV 327 + L + + Sbjct: 193 AFNFLLKVM 201 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 506 Length adjustment: 32 Effective length of query: 322 Effective length of database: 474 Effective search space: 152628 Effective search space used: 152628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory