Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_038805763.1 HK29_RS00670 SDR family NAD(P)-dependent oxidoreductase
Query= reanno::WCS417:GFF2259 (257 letters) >NCBI__GCF_000382825.1:WP_038805763.1 Length = 253 Score = 90.5 bits (223), Expect = 3e-23 Identities = 59/187 (31%), Positives = 89/187 (47%), Gaps = 7/187 (3%) Query: 7 KSALITGSARGIGRAFAQAYIAEGATVAIADIDLQRAQATAAELGPQ-----AYAVAMDV 61 K+ +ITG+ GIG A A+AY+ +G V + R +A +E + +DV Sbjct: 3 KNVVITGATSGIGEAIARAYLEQGENVVLTGRRTDRLEALKSEFAETFPNQTVWTFPLDV 62 Query: 62 TDQASIDGAITAVVAQAGKLDILINNAAL-FDLAPIVDITRDSYDRLFSINVAGTLFTLQ 120 TD + + ++ G++DIL+NNA L LAP D + NV G + + Sbjct: 63 TDMTMVKTVCSDILETIGQIDILVNNAGLALGLAPYQDYEELGMLTMLDTNVKGLMAVTR 122 Query: 121 AAARQMIRQGHGGKIINMASQAGRRGEPLVAIYCATKAAVISLTQSAGLNLIKQGINVNA 180 M++ G IINM S AG A+Y ATKAAV + + ++ I I V Sbjct: 123 CFLPAMVKANQG-HIINMGSTAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTT 181 Query: 181 IAPGVVD 187 I PG+V+ Sbjct: 182 IQPGIVE 188 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 253 Length adjustment: 24 Effective length of query: 233 Effective length of database: 229 Effective search space: 53357 Effective search space used: 53357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory