Align Aromatic amino acid transport protein AroP (characterized, see rationale)
to candidate WP_038805943.1 HK29_RS02745 amino acid permease
Query= uniprot:Q4KIP0 (466 letters) >NCBI__GCF_000382825.1:WP_038805943.1 Length = 445 Score = 312 bits (799), Expect = 2e-89 Identities = 168/461 (36%), Positives = 269/461 (58%), Gaps = 31/461 (6%) Query: 10 LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMI 69 ++RGL NRH+Q++A+ G IGTGLFLG+ + GPS+IL Y I G FL+MR +GEM+ Sbjct: 1 MERGLTNRHVQVMAIAGTIGTGLFLGAGRSISLTGPSIILIYMITGAFMFLMMRAVGEML 60 Query: 70 VEEPVAGSFSHFAHKYWGGYFGFLAGWNYWVLYVLVGMAELTAVGKYVQFWWPEIPTWVS 129 ++P +F +F ++ G +G+ + W+YW+ V +GMAE+TA+ YVQFW+P P+W+ Sbjct: 61 YQDPEQHTFINFITRHLGKGWGYFSVWSYWLSVVFIGMAEITAISHYVQFWFPSWPSWLI 120 Query: 130 AAVFFVLVNLINMMNVKFFGEAEFWFAIIKVVAIVGMIVLGCYMLFSG--SGGSQASVSN 187 VF ++ L+N++ VK FGE EFWFA++K+VAI+ MI G +M+ +G + AS++N Sbjct: 121 QIVFLTILALVNLIAVKLFGEVEFWFAMVKIVAILAMIATGAFMVLTGFETSHGTASLAN 180 Query: 188 LWSHGGFFPNGGTGLLMAMAFIMFSFGGLELVGITAAEAAEPRKVIPKAINQVVYRVLIF 247 + FPNG +MA + F++ +E +G+T +E PR+V+PKA+ ++ R++ F Sbjct: 181 ISDQFSLFPNGVMNFVMAFQMVFFAYLMIEFIGVTTSETKNPRQVLPKAVKEIPLRIVFF 240 Query: 248 YVGALAVLLSLYPWDELLVSLNAGGDAYSSSPFVKIFSLIGSDAAAQILNFVVLTAALSV 307 Y GAL ++S+ PW EL A S SPFV +F L G AA ++NFVVLT+A S Sbjct: 241 YGGALLAIMSIIPWREL---------ASSDSPFVTVFELAGIKWAAALINFVVLTSAASA 291 Query: 308 YNSGVYCNSRMLYGLAEQGDAPKALMK------LNKQGVPILALGISALITLLCVLVNYL 361 NS +Y R LY +A D+P +K L++ VP A+ SA++ L +N L Sbjct: 292 LNSTLYSTGRHLYQIAH--DSPNRFLKAIKADTLSRHNVPQNAIIASAILIALAAFINVL 349 Query: 362 -APHEALELLFALVVAALMINWALISLTHLRFRKA---MAEQGVVPSFKAFWSPLSNYLC 417 +A L+ A + + LI + HL++RK+ MA+ ++P ++ L N L Sbjct: 350 PGVSDAFALITASSSGVYIAIYILIMVAHLKYRKSQDFMADGYLMPQYR-----LLNPLT 404 Query: 418 LAFMVMIVGVMWMIPGIRASVYAIPVWVLVIWGFYLLSRAK 458 + F + + +++ +W++ GF + S+ K Sbjct: 405 ILFFIFVFATLFLQESTFMGAVGSAIWII---GFGIYSQWK 442 Lambda K H 0.327 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 561 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 445 Length adjustment: 33 Effective length of query: 433 Effective length of database: 412 Effective search space: 178396 Effective search space used: 178396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory