Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_001000837.1 HK29_RS08500 SDR family oxidoreductase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_000382825.1:WP_001000837.1 Length = 266 Score = 112 bits (281), Expect = 6e-30 Identities = 86/264 (32%), Positives = 122/264 (46%), Gaps = 18/264 (6%) Query: 7 GKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVT 66 GK LVTGA IG A L E G +A D++ L + DVT Sbjct: 9 GKTVLVTGASSGIGKAIVEELLELGVNVANFDLSDNDLRHPNLLFVK---------VDVT 59 Query: 67 SEEAVIGTVDSVVRDFGKIDFLFNNAGYQ------GAFAPVQDYPSDD--FARVLTINVT 118 S V V +V FG ID + NNAG A P Y DD F +V IN Sbjct: 60 SRSEVEEGVAKIVERFGNIDAVVNNAGINIPRLLIDAENPKGPYELDDETFEKVTMINQK 119 Query: 119 GAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPY 178 G + V +AV R ++ G IVN AS AG++G +AY +K A+ + T + A +L + Sbjct: 120 GLYLVSQAVGRILVKNGKGVIVNMASEAGLEGSEGQSAYAATKAAVYSYTRSWAKELGKH 179 Query: 179 NIRVNAISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIP 238 +RV I+PG M + E +A ++ + + + P+ R G + E+ Sbjct: 180 GVRVVGIAPGIMEATGLRTLSYE-EALAYTRGKTVEDIRAGYASTSTTPLGRSGKLREVA 238 Query: 239 GVVAFLLGDDSSFMTGVNLPIAGG 262 +VAF + D SS++TGV IAGG Sbjct: 239 DLVAFYISDRSSYITGVTTNIAGG 262 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 266 Length adjustment: 25 Effective length of query: 237 Effective length of database: 241 Effective search space: 57117 Effective search space used: 57117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory