Align SDR family oxidoreductase (characterized, see rationale)
to candidate WP_038806392.1 HK29_RS07850 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:A0A4P7ABK7 (254 letters) >NCBI__GCF_000382825.1:WP_038806392.1 Length = 243 Score = 118 bits (295), Expect = 1e-31 Identities = 79/255 (30%), Positives = 132/255 (51%), Gaps = 22/255 (8%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLLDVTDD 66 +L K V +T +++GIG A FA+ GA V+ + E LA + ++ ++ D Sbjct: 2 QLTNKNVFVTGSSRGIGLAIAHKFAQLGANVVLNSRGEISEELLAEFSNYGVKVVPISGD 61 Query: 67 -----DA---IKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIR 118 DA I +A++G+VDVL N AG +L+ ++ ++ +N F+ + Sbjct: 62 VSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEQDFEKVIKINLTGAFNMTQ 121 Query: 119 AVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNA 178 AVL M+ + G+I+N++S + G + Y ASKA ++G TKSVA + ++ +R NA Sbjct: 122 AVLKQMIKAREGAIINMSSVVG-LMGNIGQANYAASKAGLIGFTKSVAREVANRNVRVNA 180 Query: 179 ICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDES 238 + PG IES T D+V+ A +A+ PM G+AE +A ++LA + Sbjct: 181 LAPGMIESDM-----------TAVLSDKVKEATLAQIPMKHFGQAEHIADTTVFLAGQD- 228 Query: 239 NFTTGSIHMIDGGWS 253 + TG + +DGG S Sbjct: 229 -YLTGQVLAVDGGLS 242 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 243 Length adjustment: 24 Effective length of query: 230 Effective length of database: 219 Effective search space: 50370 Effective search space used: 50370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory