Protein WP_021232736.1 in Novosphingobium lindaniclasticum LE124
Annotation: NCBI__GCF_000445125.1:WP_021232736.1
Length: 419 amino acids
Source: GCF_000445125.1 in NCBI
Candidate for 12 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-fucose catabolism | fucP | hi | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease (characterized) | 42% | 93% | 327.4 | D-mannitol and D-mannose transporter (MFS superfamily) | 38% | 253.4 |
D-fructose catabolism | fruP | med | MFS transporter, FHS family, L-fucose permease (characterized, see rationale) | 41% | 93% | 298.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
sucrose catabolism | fruP | med | MFS transporter, FHS family, L-fucose permease (characterized, see rationale) | 41% | 93% | 298.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
D-cellobiose catabolism | MFS-glucose | med | Glucose/galactose transporter (characterized, see rationale) | 41% | 94% | 276.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
D-glucose catabolism | MFS-glucose | med | Glucose/galactose transporter (characterized, see rationale) | 41% | 94% | 276.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
lactose catabolism | MFS-glucose | med | Glucose/galactose transporter (characterized, see rationale) | 41% | 94% | 276.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
D-maltose catabolism | MFS-glucose | med | Glucose/galactose transporter (characterized, see rationale) | 41% | 94% | 276.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
sucrose catabolism | MFS-glucose | med | Glucose/galactose transporter (characterized, see rationale) | 41% | 94% | 276.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
trehalose catabolism | MFS-glucose | med | Glucose/galactose transporter (characterized, see rationale) | 41% | 94% | 276.9 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
D-mannose catabolism | gluP | lo | D-mannitol and D-mannose transporter (MFS superfamily) (characterized) | 38% | 92% | 253.4 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
D-galactose catabolism | HP1174 | lo | Glucose/galactose porter (characterized) | 36% | 93% | 238.8 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
2-deoxy-D-ribose catabolism | deoP | lo | 2-Deoxy-D-ribose porter, DeoP (characterized) | 32% | 95% | 225.3 | L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease | 42% | 327.4 |
Sequence Analysis Tools
View WP_021232736.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MAEEPQGGRFVTPGFMAGFALVTAVFFAWALANNLNDILIRQFQKALALSRTEAGFIQFV
FYLAYFLWAVPAGLLLRRFGYRAGLLLGLGLYAAGALLFYPAAELHRYGAFLLALFVLAS
GAAFLETAANPFIARFGSPERASQRLTLAQAFNGLGAVMAPLVGGIFIFSGVEHSPDQIA
AMSEAQLQLYRASEAAMVQGPYLVLALLVILLGLALAKVRLPTVAQDTGLTEGGGHLRAV
VRNGQLRAAVVAQFFYVGAQVGIWSYFVDFVKHLMPDTPEKTAAFYLSGSLLLFMVGRFV
GAGLMHRIRPTRLLGVFALCNAGLMVLAMTLGGGAAVAALGLASFFMSIMFPTIFALGIR
DLDEGTALGSSLIIMAIIGGAVFPPLMGLVSERSDLQIALVLPLLCFAAVAIFAKAARD
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory