Align glucosamine-6-phosphate deaminase subunit (EC 3.5.99.6) (characterized)
to candidate WP_022529337.1 L248_RS06470 glucosamine-6-phosphate deaminase
Query= metacyc::MONOMER-13104 (235 letters) >NCBI__GCF_000469325.1:WP_022529337.1 Length = 235 Score = 272 bits (696), Expect = 4e-78 Identities = 137/233 (58%), Positives = 164/233 (70%) Query: 1 MKIIQVENQVEGGKVALELLKEKLAQGAKTLGLATGSSPEEFYKQIVESDLDFSEMTSVN 60 M II V++ EGG+ A + KE LA AK GLATGS+P Y + SDLDFS+ S+N Sbjct: 1 MNIITVKDAQEGGQKAFNIFKEALAADAKVFGLATGSTPITLYNALTASDLDFSQKISIN 60 Query: 61 LDEYVGLQEEDPQSYRYFMNQHLFNQKPFKASFLPNGAAKDLEAEVARYNQLLTEHPADL 120 LDEYVGL ++PQSY YFM QHLFNQKPFK S++PNG AKD +AE RY+ ++ +P DL Sbjct: 61 LDEYVGLAPDNPQSYHYFMQQHLFNQKPFKTSYVPNGLAKDADAETQRYDDIIAANPIDL 120 Query: 121 QILGIGTNGHIGFNEPGTSFDSQTHLVDLTPSTIQSNARFFDKMEDVPTQAISMGIGNIL 180 QILGIG NGHIGFNEPG+ + +TH V LT STI +NARFFD EDVP A SMGIG+I+ Sbjct: 121 QILGIGRNGHIGFNEPGSPLNGKTHKVPLTQSTIDANARFFDNEEDVPRFAYSMGIGSIM 180 Query: 181 NAKSIILFAYGSAKAKAIAGTVEGEVTEELPGSALQKHPDVVIIADKEALSLL 233 AK I+L AYG KA AI VEG VT +P SALQ H V +I D+ A S L Sbjct: 181 TAKHILLMAYGENKADAIQKMVEGPVTNHVPASALQNHNHVTVIVDEAAASKL 233 Lambda K H 0.313 0.132 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 235 Length adjustment: 23 Effective length of query: 212 Effective length of database: 212 Effective search space: 44944 Effective search space used: 44944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_022529337.1 L248_RS06470 (glucosamine-6-phosphate deaminase)
to HMM TIGR00502 (nagB: glucosamine-6-phosphate deaminase (EC 3.5.99.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00502.hmm # target sequence database: /tmp/gapView.2797963.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00502 [M=259] Accession: TIGR00502 Description: nagB: glucosamine-6-phosphate deaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-78 248.2 0.1 4.7e-78 248.1 0.1 1.0 1 NCBI__GCF_000469325.1:WP_022529337.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000469325.1:WP_022529337.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 248.1 0.1 4.7e-78 4.7e-78 1 247 [. 1 233 [. 1 235 [] 0.93 Alignments for each domain: == domain 1 score: 248.1 bits; conditional E-value: 4.7e-78 TIGR00502 1 mklliletyeelsklaariiaekinefkpdaerpfvlGlatGgtPvglykqlielykagkvsfkkvvtfnlde 73 m +++++ ++e ++ a +i +e + + da+ v+GlatG+tP++ly++l a +++f++ + +nlde NCBI__GCF_000469325.1:WP_022529337.1 1 MNIITVKDAQEGGQKAFNIFKEALAA---DAK---VFGLATGSTPITLYNALT----ASDLDFSQKISINLDE 63 77888888888888888888888777...655...9**************995....789************* PP TIGR00502 74 yvglseehPesyhsfmyenffqhidikpeninilnGnaddleaecrryeekikslGkidlfllGiGadGhiaf 146 yvgl +++P+syh+fm++++f+ k +++nG a+d +ae +ry++ i + idl++lGiG++Ghi+f NCBI__GCF_000469325.1:WP_022529337.1 64 YVGLAPDNPQSYHYFMQQHLFNQKPFK--TSYVPNGLAKDADAETQRYDDIIA-ANPIDLQILGIGRNGHIGF 133 *********************987665..5689****************9886.679**************** PP TIGR00502 147 nePgsslesrtrvktltedtiiansrffegdvnkvPkkaltvGiktildskevlllvsGkekaeavkklvegs 219 nePgs l+ +t+ + lt++ti an+rff++ + vP+ a ++Gi+ i+ +k++ll++ G++ka+a++k+veg+ NCBI__GCF_000469325.1:WP_022529337.1 134 NEPGSPLNGKTHKVPLTQSTIDANARFFDN-EEDVPRFAYSMGIGSIMTAKHILLMAYGENKADAIQKMVEGP 205 *****************************6.578*************************************** PP TIGR00502 220 vnedvtisalqlhkkvivvadeeaaqel 247 v++ v++salq h++v+v++de+aa++l NCBI__GCF_000469325.1:WP_022529337.1 206 VTNHVPASALQNHNHVTVIVDEAAASKL 233 *************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (259 nodes) Target sequences: 1 (235 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 19.93 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory