Align phosphotransacetylase (EC 2.3.1.8) (characterized)
to candidate WP_022528623.1 L248_RS03165 phosphate acetyltransferase
Query= metacyc::MONOMER-13062 (328 letters) >NCBI__GCF_000469325.1:WP_022528623.1 Length = 328 Score = 385 bits (989), Expect = e-112 Identities = 199/326 (61%), Positives = 247/326 (75%), Gaps = 4/326 (1%) Query: 1 MDLFESLKSKIKDRKIKLVFPEGEDERIISAASRLANDDLAIPVLLGNEAEIKKTADALN 60 MDLF SL+ KI+ + I++VFPEG + RII AA RL + + P+LLG A ++ A+ Sbjct: 1 MDLFASLQQKIQGKDIRIVFPEGTEPRIIGAAVRLNAERILTPILLGTPAAVQAAAEKAG 60 Query: 61 VSLDGIEIVDIENVPGEVRQQMVQAIVERRKGKTTADQAAQWLKDPNYFGTTMVYMDDVD 120 +L I+I+D ++ +V + V+RRKGK T +Q L+DPNYFGT +VY D Sbjct: 61 FTLGNIQILDPQDYADF--DSLVASFVDRRKGKNTKEQGETMLRDPNYFGTMLVYTGLAD 118 Query: 121 GMVSGAAHPTGDTVRPALQIIKTKPGVNLISGSFVMQKGD--QRYLFADCAININPNETQ 178 GMVSGA H TG+TVRPALQIIKTKPGV+ SG+F+MQ+G +RY+FADCAINI+PN + Sbjct: 119 GMVSGAVHSTGETVRPALQIIKTKPGVSRTSGAFIMQRGRDAERYIFADCAINIDPNAQE 178 Query: 179 LAEIAVESGKTARLFDIDPRVALLSFSTNGSAKSPEVEKVHNATKLAQEMDPAMPIDGEM 238 LAEIAV S +TA+LFDIDP VA+LSFST GSAK+P+V+KV ATK+A E+ P + +DGE+ Sbjct: 179 LAEIAVASAQTAKLFDIDPHVAMLSFSTKGSAKAPQVDKVVEATKIAHELAPDLDLDGEL 238 Query: 239 QFDAAFVPAVAKAKYSDSKVAGHATVFVFPELQSGNIGYKIAQRMGGFEAIGPILQGLNK 298 QFDAAFVP+V K S VAG ATVF+FP+LQSGNIGYKIAQR G FEAIGPILQGLNK Sbjct: 239 QFDAAFVPSVGAQKAPGSTVAGKATVFIFPDLQSGNIGYKIAQRFGHFEAIGPILQGLNK 298 Query: 299 PVSDLSRGCNAEDVYKVSIITATQAL 324 PVSDLSRG N EDVYK++IITA Q L Sbjct: 299 PVSDLSRGSNEEDVYKLAIITAAQTL 324 Lambda K H 0.315 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 328 Length adjustment: 28 Effective length of query: 300 Effective length of database: 300 Effective search space: 90000 Effective search space used: 90000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_022528623.1 L248_RS03165 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.2126843.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-123 396.7 0.0 4.6e-123 396.5 0.0 1.0 1 NCBI__GCF_000469325.1:WP_022528623.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000469325.1:WP_022528623.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 396.5 0.0 4.6e-123 4.6e-123 1 304 [] 18 320 .. 18 320 .. 0.99 Alignments for each domain: == domain 1 score: 396.5 bits; conditional E-value: 4.6e-123 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverlyekrk 73 iv+PEg+e+r++ Aa l+ ++i++++ll+ +++++ +a++ +lg++++ dp+ + d +++v ++++rk NCBI__GCF_000469325.1:WP_022528623.1 18 IVFPEGTEPRIIGAAVRLNAERILTPILLGTPAAVQA-AAEKAGFTLGNIQILDPQDYADFDSLVASFVDRRK 89 8******************************999998.999******************************** PP TIGR00651 74 hkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfimekee..e 144 k t+++ +++lrD+++++++lv++g adg+vsGav++t +t+rpalqiikt++gv+ +s+ fim+++ e NCBI__GCF_000469325.1:WP_022528623.1 90 GK-NTKEQGETMLRDPNYFGTMLVYTGLADGMVSGAVHSTGETVRPALQIIKTKPGVSRTSGAFIMQRGRdaE 161 **.89999***********************************************************987669 PP TIGR00651 145 vlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvkilkekepdll 217 +++faDCa+++dPna+eLAeiA+ sa++ak ++ ++p+va+ls+stkgs+k+ +v+kv+eA+ki++e +pdl NCBI__GCF_000469325.1:WP_022528623.1 162 RYIFADCAINIDPNAQELAEIAVASAQTAKLFD-IDPHVAMLSFSTKGSAKAPQVDKVVEATKIAHELAPDLD 233 ********************************9.*************************************** PP TIGR00651 218 ldGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPilqGlakPvnDLsRG 290 ldGelqfDaA+v++v ++kap s+vagka+vf+FPdL++GnigYki+qR++++eaiGPilqGl+kPv+DLsRG NCBI__GCF_000469325.1:WP_022528623.1 234 LDGELQFDAAFVPSVGAQKAPGSTVAGKATVFIFPDLQSGNIGYKIAQRFGHFEAIGPILQGLNKPVSDLSRG 306 ************************************************************************* PP TIGR00651 291 asvedivnvviita 304 ++ ed+++++iita NCBI__GCF_000469325.1:WP_022528623.1 307 SNEEDVYKLAIITA 320 ************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (328 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 24.46 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory