Align ABC transporter for L-asparagine and L-glutamate, periplasmic substrate-binding component (characterized)
to candidate WP_022529984.1 L248_RS09480 transporter substrate-binding domain-containing protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_771 (304 letters) >NCBI__GCF_000469325.1:WP_022529984.1 Length = 274 Score = 109 bits (272), Expect = 8e-29 Identities = 77/240 (32%), Positives = 121/240 (50%), Gaps = 12/240 (5%) Query: 30 LKKIKESGTITLGHRDASIPFSYIADASGKPVGYSHDIQLKIVEAIKKDLDMPNLQVKYN 89 L + K + +IT G ++ + F + + G+ G+ DI ++ I N+Q+ + Sbjct: 34 LSRAKATNSITWGVKNDTRLFGLMDISDGQIKGFDIDIAKEVSHRIIGQ----NVQINFV 89 Query: 90 LVTSQTRIPLVQNGTVDVECGSTTNNVERQQQVDFSVGIFEIGTKLLSKKDSAYKDFADL 149 VTSQTRIPL++NG VD + TN +R++ VDFS F G LL KK S K DL Sbjct: 90 PVTSQTRIPLLKNGNVDAIIATMTNTPDRRKVVDFSDTYFNAGQALLVKKGSPIKSVKDL 149 Query: 150 -KGKNVVTTAGTTSERILKSMNADKQMGMNVISAKDHGESFQMLETGRAVAFMMDDALLA 208 KG V+ G+ S + +K + D Q V+ D+ ++F L++G+ A D+ +L Sbjct: 150 KKGTKVIGVQGSNSVQNIKKVAPDAQ----VLQLSDYAQAFTALQSGQGDALTTDNGILY 205 Query: 209 GEMAKAKKPTDWAVTGTAQSNEIYGCMVRKGDAPFKKAVDDAIIATYKSGEINKIYEKWF 268 G A P ++ V G + E Y V KG F V+ A+ + + G +I +KWF Sbjct: 206 G--MSADNP-NYVVVGGTFTKEPYAIAVNKGQKAFLDDVNLALTSMRQDGTYKQIEDKWF 262 Lambda K H 0.315 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 274 Length adjustment: 26 Effective length of query: 278 Effective length of database: 248 Effective search space: 68944 Effective search space used: 68944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory