Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_022530223.1 L248_RS10630 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_000469325.1:WP_022530223.1 Length = 249 Score = 249 bits (635), Expect = 5e-71 Identities = 126/253 (49%), Positives = 177/253 (69%), Gaps = 11/253 (4%) Query: 2 YKLEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKIL 61 Y++++QD+ K YGS+ V+K ++L A +V+ +IG SG+GKST LR IN LE +G IL Sbjct: 7 YRVQMQDVSKDYGSNHVIKDINLNVANNEVVVLIGPSGAGKSTVLRMINGLETTTSGHIL 66 Query: 62 LNNEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGM 121 + DGA + + R+R ++ MVFQHFNL+ HMT +EN++ APV + Sbjct: 67 I-----------DGADISQPHVDINRIREKIGMVFQHFNLFPHMTVLENVILAPVELKKA 115 Query: 122 SKAEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALD 181 KA A +A +L VG+ + DAYP +SGG+QQRVAIARALAM P++MLFDEPTSALD Sbjct: 116 DKAAATAEARQFLQTVGLMDKADAYPASLSGGQQQRVAIARALAMHPDIMLFDEPTSALD 175 Query: 182 PELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQ 241 PE+VGDVL VM+ LA++G TM++VTHEMGFA+EV++++VF G + E G+P E+ +PQ Sbjct: 176 PEMVGDVLAVMRQLAEQGMTMIIVTHEMGFAKEVADRVVFFESGQILEQGSPAEIFDHPQ 235 Query: 242 SERLQQFLSGSLK 254 R Q+FL+ L+ Sbjct: 236 EARTQEFLNKVLQ 248 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 249 Length adjustment: 24 Effective length of query: 230 Effective length of database: 225 Effective search space: 51750 Effective search space used: 51750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory