Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate WP_155828613.1 L248_RS09035 ABC transporter permease subunit
Query= reanno::Smeli:SM_b21104 (298 letters) >NCBI__GCF_000469325.1:WP_155828613.1 Length = 285 Score = 144 bits (363), Expect = 2e-39 Identities = 82/270 (30%), Positives = 141/270 (52%), Gaps = 2/270 (0%) Query: 12 LLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVLTNAEFWVAFGR 71 + LPA ++ VF+V+P++ ++Y +F + L VF+GF+N+VN N F A Sbjct: 1 MTLPALLLYGVFLVIPILMAIYFAFHTWNGITGSPL-VFVGFQNFVNAFNNPLFQTAMRN 59 Query: 72 TVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFKFLFNDNI 131 V ++ ++ + L LA+ +N G+R + P +F +G + F+F N Sbjct: 60 MVEMVVFSVMFHTPVALILAVALNARVKGKRFFKFVYFVPTVFPLTAIGLLWFFIFMPN- 118 Query: 132 GFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAMPKDPVEA 191 G +N L S+GL A WLI A+ +II +W+ + I++LAGL +P D EA Sbjct: 119 GSINTLLTSIGLGSLAQGWLIQPATAMPTIIFVNIWAGIGYYMIILLAGLKGIPSDVYEA 178 Query: 192 AHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKRTELLWTL 251 A +DG QTF +T P L P + + + + + +D++ +MT GGP T + TL Sbjct: 179 ALIDGANARQTFFRITLPILRPIILLCIVLDIIGTVKVFDLIFVMTGGGPNGLTNVPTTL 238 Query: 252 IGRTAYGDARMGMANAMAYVAILLSIFFTV 281 I A+ GMA+A+ + +++++ T+ Sbjct: 239 IYYEAFRYDNYGMASAIGVILLIITVTATL 268 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 285 Length adjustment: 26 Effective length of query: 272 Effective length of database: 259 Effective search space: 70448 Effective search space used: 70448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory