Align Putative amino-acid binding periplasmic protein (characterized, see rationale)
to candidate WP_022529984.1 L248_RS09480 transporter substrate-binding domain-containing protein
Query= uniprot:Q92PA9 (260 letters) >NCBI__GCF_000469325.1:WP_022529984.1 Length = 274 Score = 94.0 bits (232), Expect = 3e-24 Identities = 68/215 (31%), Positives = 104/215 (48%), Gaps = 19/215 (8%) Query: 46 SDGTLTGFDIDIAKALCEEM---KAECTFVTQDWDGIIPALIAKKFDAIVASMSITEERK 102 SDG + GFDIDIAK + + + FV IP L DAI+A+M+ T +R+ Sbjct: 60 SDGQIKGFDIDIAKEVSHRIIGQNVQINFVPVTSQTRIPLLKNGNVDAIIATMTNTPDRR 119 Query: 103 QQVDFTNKYYNTPPAIVVPKDSPITEATAAALSGKALGAQGSTTHSNYAEAHMKESEVKL 162 + VDF++ Y+N A++V K SPI K +G QGS + N + ++L Sbjct: 120 KVVDFSDTYFNAGQALLVKKGSPIKSVKDLKKGTKVIGVQGSNSVQNIKKVAPDAQVLQL 179 Query: 163 YPTADEYKLDLANGRIDAAIDDVVVLSEWLKTEDGACCKLLGTLPIDPVING----EGAG 218 A + L +G+ DA L T++G + P V+ G E Sbjct: 180 SDYAQAFTA-LQSGQGDA-----------LTTDNGILYGMSADNPNYVVVGGTFTKEPYA 227 Query: 219 IAIRKGDDALREKLNKAIEAIRANGKYKQINEKYF 253 IA+ KG A + +N A+ ++R +G YKQI +K+F Sbjct: 228 IAVNKGQKAFLDDVNLALTSMRQDGTYKQIEDKWF 262 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 274 Length adjustment: 25 Effective length of query: 235 Effective length of database: 249 Effective search space: 58515 Effective search space used: 58515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory