Align beta-Phosphoglucomutase (EC 5.4.2.6) (characterized)
to candidate WP_022528084.1 L248_RS00630 HAD family phosphatase
Query= BRENDA::P71447 (221 letters) >NCBI__GCF_000469325.1:WP_022528084.1 Length = 216 Score = 83.2 bits (204), Expect = 4e-21 Identities = 61/189 (32%), Positives = 96/189 (50%), Gaps = 12/189 (6%) Query: 2 FKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLAD 61 F V+FD+DGV+ D+ + RA A + G+ + L G + D+ KI Sbjct: 3 FDGVIFDMDGVLVDSERMYLRANLAAGQAQGLTLTAADY-APLAGAANADA--KIF--FQ 57 Query: 62 KKVSAEEFKELAKRKNDNYVKMIQDVSPAD--VYPGILQLLKDLRSNKIKIALASASKNG 119 K E+ +E +D Y + Q V+ D + PG+ LL L I +A+ S++ Sbjct: 58 KYFPGEKAQEFL---DDTYALVDQYVAAGDLKIKPGVKTLLTTLHQKGIPLAVGSSNYGR 114 Query: 120 PF--LLEKMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQA 177 L + + FD I +VAA KPAPDIF+AAAHA+ +AP+ ++ +EDS G+QA Sbjct: 115 TVNEFLTAVGIKDAFDHIITSDDVAAGKPAPDIFLAAAHALHIAPARALVVEDSANGVQA 174 Query: 178 IKDSGALPI 186 ++ P+ Sbjct: 175 ALNARMTPV 183 Lambda K H 0.316 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 221 Length of database: 216 Length adjustment: 22 Effective length of query: 199 Effective length of database: 194 Effective search space: 38606 Effective search space used: 38606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory