Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_022528026.1 L248_RS00360 sugar ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000469325.1:WP_022528026.1 Length = 515 Score = 107 bits (268), Expect = 4e-28 Identities = 66/225 (29%), Positives = 111/225 (49%), Gaps = 11/225 (4%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L +GLSKSFG R +DH D+ VK+GS+ GL+G NGAGK+T+ L D+G+ Sbjct: 22 MLSIRGLSKSFGRNRVLDHIDMDVKKGSVMGLMGENGAGKSTMMKCLFGIKTRDEGKFYL 81 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 +G + P G Q +V++N+ FL R Sbjct: 82 DGKEVSFQGPKDALENGIAMVHQELNQALDRSVVDNL-----------FLGRYPVNALGV 130 Query: 138 KEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGV 197 +ER R +A + +G+ +S QR+++E+A+A+ + K+I+LDEP + + Sbjct: 131 VDERQMRREATELFRRLGMTVNLTQPMRKMSVSQRQMVEIAKAISYHSKVIVLDEPTSSL 190 Query: 198 NPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEG 242 + ++ + + +QGI+ + I H MD + +C V VL +G Sbjct: 191 MAQEVDKLFDMVRMLKKQGISIIFISHKMDEVFQICDEVSVLRDG 235 Score = 60.8 bits (146), Expect = 6e-14 Identities = 59/248 (23%), Positives = 103/248 (41%), Gaps = 20/248 (8%) Query: 1 MSDRITPAENLGSPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTL 60 + +R P +N+ ++L LS F + V +G I GL G GAG+T L Sbjct: 260 LDNRFPPVDNVVG--KTILQVSHLSTKFSPY--LQDITFSVGQGEIFGLYGLVGAGRTEL 315 Query: 61 FNLLSNFIRPDQGEVLFNG-----DSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENML 115 + G V FNG +S + H A+ R + LT + Sbjct: 316 LETIFGVRTRAAGRVYFNGKLANFNSAKEAMDHGFAMITEERKANGLFLKGSLTFNTTIT 375 Query: 116 LADQHQTGEKFLPRLINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLL 175 D ++ G + + + KE + K M E + +LSGG ++ + Sbjct: 376 NLDAYKRGVALSEQKMT-KATLKEIQVMNTKTMGPDELIA----------SLSGGNQQKV 424 Query: 176 EMARALMSNPKLILLDEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHH 235 + + L P+L ++DEP G++ +I E I+ +QG T +V+ M I+ + + Sbjct: 425 IIGKWLERLPQLFMMDEPTRGIDVGAKYEIYELIIQMAKQGKTIIVVSSEMPEILGITNR 484 Query: 236 VWVLAEGR 243 + V++ GR Sbjct: 485 IGVMSNGR 492 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 267 Length of database: 515 Length adjustment: 30 Effective length of query: 237 Effective length of database: 485 Effective search space: 114945 Effective search space used: 114945 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory