Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_022529099.1 L248_RS05360 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_000469325.1:WP_022529099.1 Length = 376 Score = 253 bits (646), Expect = 6e-72 Identities = 156/384 (40%), Positives = 220/384 (57%), Gaps = 35/384 (9%) Query: 4 LKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLY 63 +KLD++ K++ + ++ + I + EF V VGPSG GKST LR+IAGL + G+++ Sbjct: 3 IKLDHLTKQFGDTA--VLDGISAQIQEGEFFVLVGPSGSGKSTLLRIIAGLIPASSGSVF 60 Query: 64 IDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEIL 123 D + + D PKDR + MVFQNYAL P MSV +N+ FGL + KRV++A +++ Sbjct: 61 FDSQNVTDLPPKDRHLTMVFQNYALLPFMSVADNIRFGLHNLDLDATEEAKRVNDALDMV 120 Query: 124 GLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHR 183 LTE +RKP +LSGGQ+QRVA+ RAI A + LMDEPLSNLDA+LR MR E+ ++H+ Sbjct: 121 HLTELRDRKPKELSGGQQQRVALARAIATKASLVLMDEPLSNLDAQLRTEMRQELVQLHK 180 Query: 184 RIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVA 243 +G T +YVTHDQ EAMT+ +RI++++ I+Q+GTP +LYN PANKFVA Sbjct: 181 ELGMTLLYVTHDQVEAMTMGERIMVLND----------HHIQQVGTPLDLYNHPANKFVA 230 Query: 244 GFIGSPAMNFFEVTVE--------KERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGI 295 FIGSP MN F+ TV+ + NQ + L LP L Y LGI Sbjct: 231 TFIGSPKMNMFDATVDALEHFATLELTDANQHSVRLPLPYD----LAAGAY-----QLGI 281 Query: 296 RPEDISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEK 355 RPE I+ + + S ++ LG ES + + EF A V + + Sbjct: 282 RPEKIT----LSRSASAGSFPVRVMAVANLGRESSVSLVNNGHEFIASVPEQYPVPENQI 337 Query: 356 VQLTF--NIAKGHFFDLETEKRIN 377 V T + A HFFD ++ +N Sbjct: 338 VYATLPTDAADLHFFDEKSNLAVN 361 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 376 Length adjustment: 30 Effective length of query: 347 Effective length of database: 346 Effective search space: 120062 Effective search space used: 120062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory