Align Trehalose/maltose transport system permease protein MalG (characterized)
to candidate WP_022528616.1 L248_RS03130 carbohydrate ABC transporter permease
Query= SwissProt::Q7LYX6 (278 letters) >NCBI__GCF_000469325.1:WP_022528616.1 Length = 272 Score = 139 bits (351), Expect = 5e-38 Identities = 93/275 (33%), Positives = 145/275 (52%), Gaps = 11/275 (4%) Query: 5 VLKRILLIIGAILMAIICLFPFIWMIVVSFAEDPTFLGSPLVEYKSTLE--NYVRVLSDP 62 VL+ ++L +GAI+M + PF WM+ S P + P V +L+ NYV Sbjct: 7 VLRYLILTLGAIIM----ILPFFWMLSTSLKTQPETIQLPPVWIPKSLQWGNYVEAFK-- 60 Query: 63 TLHFPAYLKNSIIIASLVTLTTVSISSLAAYAVSRIEFKGRLLIPIFVLGLSMFPQISLV 122 F Y NS+I+ + T+ + S LAA+A S++ F GR L+ + LG M P L+ Sbjct: 61 AAPFGRYFVNSVIVTVVTTIGQLFTSILAAFAFSKLRFWGRNLLFMIFLGTMMIPGEMLI 120 Query: 123 GYLFKFIEKLGWVNTYQALYFPYVAWTLPLSLWILLSYFSQLPKDLDEAAMIDGASRIKT 182 F + + VNTY AL P++A +++ L F+ + AA IDGAS K Sbjct: 121 IPNFVTLSNMHLVNTYGALILPWLASF--FTVFTLRQTFNSVSDQTYYAAKIDGASDWKF 178 Query: 183 LTTIILPLSAPALFSTALLVFIAAFNEFMFALLFTTDHRARTVPVGIALFQGVHGEIPWG 242 L I++P+S + + +L I ++N FM+ L+ T D RT+PVG+ F G + Sbjct: 179 LWHILVPMSKSTITAVTVLQVIGSWNSFMWPLIVTNDENMRTLPVGLQAFTTDAG-TNFA 237 Query: 243 SVMAASVISTIPLVIMALLFQKYIVSGLTAGALKG 277 +MAAS IP+V++ + QKYI++G++ LKG Sbjct: 238 LLMAASTFVIIPMVVVYIFLQKYIIAGISNSGLKG 272 Lambda K H 0.329 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 272 Length adjustment: 25 Effective length of query: 253 Effective length of database: 247 Effective search space: 62491 Effective search space used: 62491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory