Align ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized)
to candidate WP_040536760.1 L248_RS12535 carbohydrate ABC transporter permease
Query= TCDB::G4FGN6 (278 letters) >NCBI__GCF_000469325.1:WP_040536760.1 Length = 283 Score = 133 bits (335), Expect = 4e-36 Identities = 82/263 (31%), Positives = 146/263 (55%), Gaps = 5/263 (1%) Query: 17 LILIWCVFPLYWAFISSIKPDRDLFEKNPSLFPKRITFENYVKVFKER-PFHINIKNSII 75 L ++ +FPL W +S K + D+F P + NYV+V++ F + N+I Sbjct: 25 LFMLVMLFPLLWMISTSFKREIDVFNFPIQWIPPVFNWHNYVEVWQGNYNFPLYYWNTIK 84 Query: 76 VAGITTVLALVVGSLAGYAIARLKFRGKVIVMSLILAVSMFPQVSILGSLFLILRGLKLI 135 V V+ LV+ S+A YA+A++ F+ K + S+ LA M P + F++L+ + L+ Sbjct: 85 VTVAVVVIQLVISSMAAYALAKMDFKFKGFIFSMFLATMMIPDQVTIVPRFILLQTMGLL 144 Query: 136 NTYTGLIIPYTAMNLPLTVWVLQSFFRELPKEVEESAFIDGASKLRTLWSIVLPMSAPGL 195 N++ G I+ A ++ V++L+ +P + E+A +DGA+ L+ I++PM L Sbjct: 145 NSHAGYIL-MLAFSV-YGVFLLRQSVITIPDSLIEAARMDGATHLQIFIQIIIPMLKSSL 202 Query: 196 VATGLLTFIAAWNEFLFALTFMQKPSLYTVPVAVALFKGASQYEIPWGQLMAAAVIVTLP 255 +L F+ WN++ L F + L+T+ + ++ F ASQ + LMAA+V+ +P Sbjct: 203 ATLAILRFVWTWNDYQNPLIFFRDQKLFTLQLGMSQF--ASQAGTYYALLMAASVLAIVP 260 Query: 256 LVILVLVFQNRIIAGLSAGAVKG 278 L+I+ ++ Q I+ G++AGAVKG Sbjct: 261 LLIIFIIGQRYIMDGMTAGAVKG 283 Lambda K H 0.329 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 283 Length adjustment: 26 Effective length of query: 252 Effective length of database: 257 Effective search space: 64764 Effective search space used: 64764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory