Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_022528734.1 L248_RS03710 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000469325.1:WP_022528734.1 Length = 374 Score = 247 bits (631), Expect = 3e-70 Identities = 131/254 (51%), Positives = 172/254 (67%), Gaps = 7/254 (2%) Query: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 I++ + K +G T L DI I +GEF V VGPSG GKST+LR +AGL +SG I Sbjct: 3 IQLTHLTKHFGDTPVLDDITATINEGEFYVLVGPSGSGKSTILRIIAGLIPATSGDIYFD 62 Query: 64 GRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQL 123 + VT P DR LAMVFQ+YAL P M+V EN+ FG+ R+A+A +++ L Sbjct: 63 DKKVTDAAPKDRHLAMVFQNYALLPFMSVAENIRFGLHNLHLSTADEDARVADALQMVHL 122 Query: 124 EDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQL 183 D DRKP +LSGGQ+QRVA+ RAI ++ L DEPLSNLDA+LR +MR EL LHK L Sbjct: 123 SDLADRKPKELSGGQQQRVAVARAIATQANLVLMDEPLSNLDAQLRTEMREELVELHKAL 182 Query: 184 GATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMNVFS 243 T+IYVTHDQ EAMTM ++I+VLN RI+QVG+P++LY+ P + FVA FIGSP MN+F+ Sbjct: 183 KMTLIYVTHDQTEAMTMGERIMVLNDHRIQQVGTPLELYNHPQNAFVATFIGSPKMNMFT 242 Query: 244 SDVGLQDISLDASA 257 +++DA+A Sbjct: 243 -------VTVDAAA 249 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 374 Length adjustment: 29 Effective length of query: 309 Effective length of database: 345 Effective search space: 106605 Effective search space used: 106605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory