Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_022529099.1 L248_RS05360 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000469325.1:WP_022529099.1 Length = 376 Score = 255 bits (652), Expect = 1e-72 Identities = 147/325 (45%), Positives = 197/325 (60%), Gaps = 22/325 (6%) Query: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 IK+D + K +G T L I+ I++GEF V VGPSG GKSTLLR +AGL SSG + Sbjct: 3 IKLDHLTKQFGDTAVLDGISAQIQEGEFFVLVGPSGSGKSTLLRIIAGLIPASSGSVFFD 62 Query: 64 GRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQL 123 ++VT + P DR L MVFQ+YAL P M+V +N+ FG+ + +R+ +A ++ L Sbjct: 63 SQNVTDLPPKDRHLTMVFQNYALLPFMSVADNIRFGLHNLDLDATEEAKRVNDALDMVHL 122 Query: 124 EDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQL 183 + DRKP +LSGGQ+QRVA+ RAI S+ L DEPLSNLDA+LR +MR EL LHK+L Sbjct: 123 TELRDRKPKELSGGQQQRVALARAIATKASLVLMDEPLSNLDAQLRTEMRQELVQLHKEL 182 Query: 184 GATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMNVFS 243 G T++YVTHDQVEAMTM ++I+VLN I+QVG+P+DLY+ P ++FVA FIGSP MN+F Sbjct: 183 GMTLLYVTHDQVEAMTMGERIMVLNDHHIQQVGTPLDLYNHPANKFVATFIGSPKMNMFD 242 Query: 244 SDVGLQD--------------------ISLDASAAFVGCRPEHIEIVPDGD-GHIAATVH 282 + V + L A A +G RPE I + G V Sbjct: 243 ATVDALEHFATLELTDANQHSVRLPLPYDLAAGAYQLGIRPEKITLSRSASAGSFPVRVM 302 Query: 283 VKERLGGESLLYLGLKGGGQIVARV 307 LG ES + L + G + +A V Sbjct: 303 AVANLGRESSVSL-VNNGHEFIASV 326 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 376 Length adjustment: 29 Effective length of query: 309 Effective length of database: 347 Effective search space: 107223 Effective search space used: 107223 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory