Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_040536760.1 L248_RS12535 carbohydrate ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_000469325.1:WP_040536760.1 Length = 283 Score = 120 bits (302), Expect = 3e-32 Identities = 79/267 (29%), Positives = 135/267 (50%), Gaps = 19/267 (7%) Query: 16 LIITVCVFPFYWMVTTSLKTQIVALEAPPVWI---------FEPTLSNYREALFEDGVLR 66 L + V +FP WM++TS K +I P WI E NY L+ Sbjct: 25 LFMLVMLFPLLWMISTSFKREIDVFNFPIQWIPPVFNWHNYVEVWQGNYNFPLY------ 78 Query: 67 TLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLI 126 N++ + ++ + LV+ AA+ALA+ +F+ K ++ F+ MI V +P F++ Sbjct: 79 -YWNTIKVTVAVVVIQLVISSMAAYALAKMDFKFKGFIFSMFLATMMIPDQVTIVPRFIL 137 Query: 127 ARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICL 186 + +GLL+ H IL+ L F++ ++++ IP L EAAR++GA+ I +I + Sbjct: 138 LQTMGLLNSHAGYILM-LAFSV-YGVFLLRQSVITIPDSLIEAARMDGATHLQIFIQIII 195 Query: 187 PLAMPGVAVSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVS-FMEGYNLPYGKIMATST 245 P+ +A AI F+++WN+ LI R + + +S F Y +MA S Sbjct: 196 PMLKSSLATLAILRFVWTWNDYQNPLIFFRDQKLFTLQLGMSQFASQAGTYYALLMAASV 255 Query: 246 LIVIPVLIFALIASKQLVRGLTMGAVK 272 L ++P+LI +I + ++ G+T GAVK Sbjct: 256 LAIVPLLIIFIIGQRYIMDGMTAGAVK 282 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 283 Length adjustment: 25 Effective length of query: 247 Effective length of database: 258 Effective search space: 63726 Effective search space used: 63726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory