Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_022530416.1 L248_RS11545 sugar ABC transporter permease YjfF
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_000469325.1:WP_022530416.1 Length = 345 Score = 146 bits (368), Expect = 8e-40 Identities = 91/306 (29%), Positives = 162/306 (52%), Gaps = 12/306 (3%) Query: 30 VFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLSVGSILAFAG 89 +F +L + + F++ R +++L + +LA G+ + ILT GIDLS+G+++A Sbjct: 18 IFAILFIAGSVMYPNFLSLRVLLNLLINNAYMIVLAGGVCFTILTGGIDLSIGAVVAMTS 77 Query: 90 LCSAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSIARGMTFIL 149 + +A + G ++ + G + G V G ++ + P++ TL + ARG +++ Sbjct: 78 MIAASLLRSGMNAYLVIAICLLTGVVFGTVQGLLIQYFGLHPWIVTLAGMFFARGACYLI 137 Query: 150 N-DGSPITD-----LPDAYLALGIGKIGPIGVPIIIFAVVALIFWMVLRYTTYGRYVYAV 203 + + PI + + L LG G+ I + +I+ V + + ++T +GR YA+ Sbjct: 138 SVEAIPIKNQAFYNISQFKLYLGPGRF--ISLNVIVALVFLALCLYLAKFTKFGRTTYAL 195 Query: 204 GGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELDAIAAVV 263 GGN +SA G+ V + VY SG A L+G++ + T S E+DAIAA V Sbjct: 196 GGNRQSALLMGLPVARTKILVYTFSGFSATLSGLMFTLYTLSGYGLNANGAEMDAIAACV 255 Query: 264 IGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLG-VSSYYQQVAKGLIIVFAVLID---V 319 IGG SL GG GS+ G G L+ GVI ++ G +SS++ ++ G +++F +++ V Sbjct: 256 IGGVSLYGGIGSLFGPFIGVLVAGVIRTMVDFQGTLSSWWTKIFVGTLMLFCIVLQAVIV 315 Query: 320 WRKKKR 325 R+K R Sbjct: 316 EREKAR 321 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 345 Length adjustment: 28 Effective length of query: 297 Effective length of database: 317 Effective search space: 94149 Effective search space used: 94149 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory