Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_052000041.1 L248_RS11550 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_000469325.1:WP_052000041.1 Length = 332 Score = 187 bits (475), Expect = 3e-52 Identities = 112/303 (36%), Positives = 176/303 (58%), Gaps = 9/303 (2%) Query: 30 VFILLCVVMAFSSEYFMT-------WRNWMDILRQTSINGILAVGMTYVILTKGIDLSVG 82 + I+L + FS ++F + + +D+L + S I+++GM VI T+G+D+SVG Sbjct: 12 ILIVLLFNVFFSPKFFQISFNNGHLYGSIIDVLNRGSSLVIVSLGMCLVIATRGVDISVG 71 Query: 83 SILAFAGLCSA-MVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSI 141 S+ A + + ++ + G A+ G+ AG GV NGF+VA L+I P +ATL ++++ Sbjct: 72 SVSAVGAMVAVFLLKSAGMAAAPAILCGLLAGLACGVWNGFLVAKLNIQPMIATLILMTV 131 Query: 142 ARGMTFILNDGSPITDLPDAYLALGIGKIGPIGVPIIIFAVVALIFWMVLRYTTYGRYVY 201 RG+ I++ G +T AY LG G + I P II +V L W++ R T+ G + Sbjct: 132 GRGIAQIISGGQILTINSKAYAFLGRGYVFGIPFPTIIMILVTLGVWLLTRKTSLGTSIE 191 Query: 202 AVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSA-LPQAGVSYELDAIA 260 AVG NE SAR +GI ++++ VY++ GLLA L+G++ SA +SA G+ ELDAI Sbjct: 192 AVGINETSARYAGISTTQILWIVYIICGLLAALSGMIESANVSSADGNNNGLLLELDAIL 251 Query: 261 AVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAVLIDVW 320 AVV+GGTS+ GG + GT+ GAL I + + GV + V K L+++F VL+ Sbjct: 252 AVVLGGTSMDGGKFYLAGTVIGALFIQTLTTTIYTFGVPAETIMVVKALVVIFVVLLSTD 311 Query: 321 RKK 323 R K Sbjct: 312 RVK 314 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 332 Length adjustment: 28 Effective length of query: 297 Effective length of database: 304 Effective search space: 90288 Effective search space used: 90288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory