Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_081701178.1 L248_RS02565 hypothetical protein
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_000469325.1:WP_081701178.1 Length = 383 Score = 130 bits (327), Expect = 5e-35 Identities = 93/293 (31%), Positives = 139/293 (47%), Gaps = 25/293 (8%) Query: 47 DALVTLVTDKVDKELLENAPK--LKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDAT 104 DA+VTL T + K ++ IA VG DN+ GI ++N P + Sbjct: 91 DAVVTLQTTPYPAAVFAEMKKAGVQYIALRNVGMDNVPFPVLAANGIKLSNVPAYSPQSI 150 Query: 105 ADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQA 164 A+ A +L L + R + + S ++ ++ + G L T+G+VG GRIG + Sbjct: 151 AEFAVSLTLQLVRGFGTLNRAIASHQYTEA------MHLTGIELGTLTIGVVGTGRIGAS 204 Query: 165 LAKRAKGFGMKIIYYSRTRKPEAEEEIGAEYVD-FETLLKESDFISLHVPLTKETYHMIG 223 + +GFG ++ Y P+ + +I EYVD L D I LH+P TKE H+IG Sbjct: 205 AVQLFQGFGCTVLGYDPYPNPQLKNKI--EYVDDLADLWPRVDVIDLHIPGTKENTHLIG 262 Query: 224 EKELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEEE----PYYN----- 274 E+ MKP LINT+RG ++DTNAL++ L + I GAG+D FE E +N Sbjct: 263 APEIAQMKPGVFLINTARGNLIDTNALLQGLADDHIGGAGIDTFEYENEVIDQWNRNEAP 322 Query: 275 -----EELFKLKNVVLAPHIGSATHEAREGMAELVAKNLIAFAKGEIPPNLVN 322 + L V+ PHI T A E M + + AF + P+ V+ Sbjct: 323 ANKAYQTLMADPRVIFTPHIAYHTESAVENMVTVSLEQAKAFVQTGTAPHAVD 375 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 383 Length adjustment: 29 Effective length of query: 302 Effective length of database: 354 Effective search space: 106908 Effective search space used: 106908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory