Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_031258885.1 NSB1T_RS26085 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000473955.1:WP_031258885.1 Length = 309 Score = 95.9 bits (237), Expect = 8e-25 Identities = 59/192 (30%), Positives = 105/192 (54%), Gaps = 3/192 (1%) Query: 22 QGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIVRRG 81 +GI+FS++ GEL +IGP+GAGK++L + + L+ P G G +I + + +R Sbjct: 26 EGISFSVSQGELFGIIGPDGAGKTSLFRILTTLILPDSGTASVDGLDI--IKDYKEIRNR 83 Query: 82 MCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTMFPKLAQRRNQRAGTLSGGE 141 + Y+P +++ L+V ENL A + Q Q I ++ ++ ++++AG LSGG Sbjct: 84 VGYMPGKFSLYPDLSVEENLKFFASVFQTTIQENYYLIKDIYQQIEPFKDRKAGALSGGM 143 Query: 142 RQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAINATGKAIILVEQNAKQALM 201 +Q LA+ AL+ P +L LDEP+ + P+ K+ + +K + G ILV Sbjct: 144 KQKLALSCALIHKPSVLFLDEPTTGVDPVSRKEFWEMLKRLKNQG-ITILVSTPYMDEAR 202 Query: 202 MADRGYVLENGR 213 + DR +++ G+ Sbjct: 203 LCDRIALIKEGK 214 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 309 Length adjustment: 25 Effective length of query: 215 Effective length of database: 284 Effective search space: 61060 Effective search space used: 61060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory